KEGG   Methylobacterium extorquens DM4: METDI0155Help
Entry
METDI0155         CDS       T00947                                 

Gene name
pccB
Definition
propionyl-CoA carboxylase beta chain (EC:6.4.1.3)
Orthology
K01966  
propionyl-CoA carboxylase beta chain [EC:6.4.1.3]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    METDI0155 (pccB)
   00640 Propanoate metabolism
    METDI0155 (pccB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    METDI0155 (pccB)
Enzymes [BR:mdi01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     METDI0155 (pccB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154934..156466
Genome map
AA seq 510 aa AA seqDB search
MKDILEKLEERRAQARLGGGEKRLEAQHTRGKLTARERIELLLDHGSFEEFDMFVQHRST
DFGMEKQKIPGDGVVTGWGTVNGRTVFLFSKDFTVFGGSLSEAHAAKIVKVQDMALKMRA
PIIGIFDAGGARIQEGVAALGGYGEVFRRNVAASGVIPQISVIMGPCAGGDVYSPAMTDF
IFMVRDTSYMFVTGPDVVKTVTNEVVTAEELGGAKVHTSKSSIADGSFENDVEAILQIRR
LLDFLPANNIEGVPEIESFDDVNRLDKSLDTLIPDNPNKPYDMGELIRRVVDEGDFFEIQ
AAYARNIITGFGRVEGRTVGFVANQPLVLAGVLDSDASRKAARFVRFCNAFSIPIVTFVD
VPGFLPGTAQEYGGLIKHGAKLLFAYSQATVPLVTIITRKAFGGAYDVMASKHVGADLNY
AWPTAQIAVMGAKGAVEIIFRAEIGDADKIAERTKEYEDRFLSPFVAAERGYIDEVIMPH
STRKRIARALGMLRTKEMEQPWKKHDNIPL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacattctcgagaagcttgaggagcgtcgcgcacaggcccgtctcggcggcggg
gaaaagcggctcgaggcgcagcacacgcgcggcaagctcacggcgcgcgagcgcatcgaa
ctcctgctcgaccacgggtcgttcgaggaattcgacatgttcgtgcagcaccgctccacc
gatttcggcatggagaagcagaagatccccggcgacggcgtcgtcaccggctggggcacc
gtgaacggacgcaccgtcttcctgttctcgaaggacttcacggtgttcggcggctcgctc
tccgaggcgcacgcggccaagatcgtcaaggtccaagacatggcgctgaagatgcgcgcc
ccgatcatcggcatcttcgatgccggcggcgcccgcatccaggagggcgtggccgcgctc
ggcggctacggcgaggtgttccgccgcaacgtcgcggcctccggcgtgatcccgcagatc
tcggtcatcatggggccgtgcgcgggcggcgacgtctactcgccggctatgaccgacttc
atcttcatggtgcgcgacacgagctacatgttcgtgaccggccccgacgtggtgaagacc
gtcaccaacgaggtcgtgaccgccgaggaactcggcggcgccaaggtccacacctcgaaa
tcctcgatcgccgacggctcgttcgagaacgacgtcgaggcgatcctccagatccgccgc
ctgctcgacttcctgcccgccaacaacatcgagggcgtgccggagatcgagagcttcgac
gacgtcaaccgcctcgacaagtcgctcgacacgctgattccggacaacccgaacaagccc
tacgacatgggcgagctgatccgccgggtcgtggacgagggtgacttcttcgagatccag
gcggcttacgcccgcaacatcatcaccggcttcggccgcgtcgagggccgcaccgtcggt
ttcgtcgccaaccagccgctggtgctggctggcgtgctcgattcggacgcctcgcggaag
gcggcccgcttcgtgcgcttctgcaacgccttctcgatcccgatcgtcaccttcgtcgac
gtgccgggcttcctgccgggcacggcgcaggaatatggcggcctgatcaagcacggcgcc
aagctgcttttcgcctacagccaagccaccgtgccgctcgtgaccatcatcacccgcaag
gccttcggcggcgcctacgacgtcatggcctcgaagcatgtcggcgccgacctgaactat
gcgtggccgacggcgcagatcgcggtgatgggcgccaagggcgcggtcgagatcatcttc
cgcgccgagatcggcgatgcggacaagatcgccgagcggaccaaagaatacgaggaccgc
ttcctctcgcccttcgtggcggcggagcgcggctacatcgacgaggtgatcatgccccac
tccacccgcaagcggatcgcgcgggcgctcgggatgctgcgcaccaaggagatggagcag
ccctggaagaagcacgacaacatcccgctctga

DBGET integrated database retrieval system