KEGG   Methylobacterium extorquens DM4: METDI0155Help
Entry
METDI0155         CDS       T00947                                 

Gene name
pccB
Definition
propionyl-CoA carboxylase beta chain (EC:6.4.1.3)
Orthology
K01966  
propionyl-CoA carboxylase beta chain [EC:6.4.1.3]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Valine, leucine and isoleucine degradation
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mdi01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mdi00630]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mdi00640]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mdi00280]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
154934..156466
Genome map
AA seq 510 aa AA seqDB search
MKDILEKLEERRAQARLGGGEKRLEAQHTRGKLTARERIELLLDHGSFEEFDMFVQHRST
DFGMEKQKIPGDGVVTGWGTVNGRTVFLFSKDFTVFGGSLSEAHAAKIVKVQDMALKMRA
PIIGIFDAGGARIQEGVAALGGYGEVFRRNVAASGVIPQISVIMGPCAGGDVYSPAMTDF
IFMVRDTSYMFVTGPDVVKTVTNEVVTAEELGGAKVHTSKSSIADGSFENDVEAILQIRR
LLDFLPANNIEGVPEIESFDDVNRLDKSLDTLIPDNPNKPYDMGELIRRVVDEGDFFEIQ
AAYARNIITGFGRVEGRTVGFVANQPLVLAGVLDSDASRKAARFVRFCNAFSIPIVTFVD
VPGFLPGTAQEYGGLIKHGAKLLFAYSQATVPLVTIITRKAFGGAYDVMASKHVGADLNY
AWPTAQIAVMGAKGAVEIIFRAEIGDADKIAERTKEYEDRFLSPFVAAERGYIDEVIMPH
STRKRIARALGMLRTKEMEQPWKKHDNIPL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacattctcgagaagcttgaggagcgtcgcgcacaggcccgtctcggcggcggg
gaaaagcggctcgaggcgcagcacacgcgcggcaagctcacggcgcgcgagcgcatcgaa
ctcctgctcgaccacgggtcgttcgaggaattcgacatgttcgtgcagcaccgctccacc
gatttcggcatggagaagcagaagatccccggcgacggcgtcgtcaccggctggggcacc
gtgaacggacgcaccgtcttcctgttctcgaaggacttcacggtgttcggcggctcgctc
tccgaggcgcacgcggccaagatcgtcaaggtccaagacatggcgctgaagatgcgcgcc
ccgatcatcggcatcttcgatgccggcggcgcccgcatccaggagggcgtggccgcgctc
ggcggctacggcgaggtgttccgccgcaacgtcgcggcctccggcgtgatcccgcagatc
tcggtcatcatggggccgtgcgcgggcggcgacgtctactcgccggctatgaccgacttc
atcttcatggtgcgcgacacgagctacatgttcgtgaccggccccgacgtggtgaagacc
gtcaccaacgaggtcgtgaccgccgaggaactcggcggcgccaaggtccacacctcgaaa
tcctcgatcgccgacggctcgttcgagaacgacgtcgaggcgatcctccagatccgccgc
ctgctcgacttcctgcccgccaacaacatcgagggcgtgccggagatcgagagcttcgac
gacgtcaaccgcctcgacaagtcgctcgacacgctgattccggacaacccgaacaagccc
tacgacatgggcgagctgatccgccgggtcgtggacgagggtgacttcttcgagatccag
gcggcttacgcccgcaacatcatcaccggcttcggccgcgtcgagggccgcaccgtcggt
ttcgtcgccaaccagccgctggtgctggctggcgtgctcgattcggacgcctcgcggaag
gcggcccgcttcgtgcgcttctgcaacgccttctcgatcccgatcgtcaccttcgtcgac
gtgccgggcttcctgccgggcacggcgcaggaatatggcggcctgatcaagcacggcgcc
aagctgcttttcgcctacagccaagccaccgtgccgctcgtgaccatcatcacccgcaag
gccttcggcggcgcctacgacgtcatggcctcgaagcatgtcggcgccgacctgaactat
gcgtggccgacggcgcagatcgcggtgatgggcgccaagggcgcggtcgagatcatcttc
cgcgccgagatcggcgatgcggacaagatcgccgagcggaccaaagaatacgaggaccgc
ttcctctcgcccttcgtggcggcggagcgcggctacatcgacgaggtgatcatgccccac
tccacccgcaagcggatcgcgcgggcgctcgggatgctgcgcaccaaggagatggagcag
ccctggaagaagcacgacaacatcccgctctga

DBGET integrated database retrieval system