KEGG   Methylobacterium extorquens DM4: METDI0155Help
Entry
METDI0155         CDS       T00947                                 

Gene name
pccB
Definition
(GenBank) propionyl-CoA carboxylase beta chain
  KO
K01966  propionyl-CoA carboxylase beta chain [EC:6.4.1.3 2.1.3.15]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00280  Valine, leucine and isoleucine degradation
mdi00630  Glyoxylate and dicarboxylate metabolism
mdi00640  Propanoate metabolism
mdi01100  Metabolic pathways
mdi01120  Microbial metabolism in diverse environments
mdi01130  Biosynthesis of antibiotics
mdi01200  Carbon metabolism
Module
mdi_M00741  Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    METDI0155 (pccB)
   00640 Propanoate metabolism
    METDI0155 (pccB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    METDI0155 (pccB)
Enzymes [BR:mdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     METDI0155 (pccB)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.3  propionyl-CoA carboxylase
     METDI0155 (pccB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carboxyl_trans MdcE OHCU_decarbox NUC130_3NT
Motif
Other DBs
NCBI-ProteinID: CAX21825
UniProt: C7C6S1
Position
154934..156466
Genome map
AA seq 510 aa AA seqDB search
MKDILEKLEERRAQARLGGGEKRLEAQHTRGKLTARERIELLLDHGSFEEFDMFVQHRST
DFGMEKQKIPGDGVVTGWGTVNGRTVFLFSKDFTVFGGSLSEAHAAKIVKVQDMALKMRA
PIIGIFDAGGARIQEGVAALGGYGEVFRRNVAASGVIPQISVIMGPCAGGDVYSPAMTDF
IFMVRDTSYMFVTGPDVVKTVTNEVVTAEELGGAKVHTSKSSIADGSFENDVEAILQIRR
LLDFLPANNIEGVPEIESFDDVNRLDKSLDTLIPDNPNKPYDMGELIRRVVDEGDFFEIQ
AAYARNIITGFGRVEGRTVGFVANQPLVLAGVLDSDASRKAARFVRFCNAFSIPIVTFVD
VPGFLPGTAQEYGGLIKHGAKLLFAYSQATVPLVTIITRKAFGGAYDVMASKHVGADLNY
AWPTAQIAVMGAKGAVEIIFRAEIGDADKIAERTKEYEDRFLSPFVAAERGYIDEVIMPH
STRKRIARALGMLRTKEMEQPWKKHDNIPL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgaaggacattctcgagaagcttgaggagcgtcgcgcacaggcccgtctcggcggcggg
gaaaagcggctcgaggcgcagcacacgcgcggcaagctcacggcgcgcgagcgcatcgaa
ctcctgctcgaccacgggtcgttcgaggaattcgacatgttcgtgcagcaccgctccacc
gatttcggcatggagaagcagaagatccccggcgacggcgtcgtcaccggctggggcacc
gtgaacggacgcaccgtcttcctgttctcgaaggacttcacggtgttcggcggctcgctc
tccgaggcgcacgcggccaagatcgtcaaggtccaagacatggcgctgaagatgcgcgcc
ccgatcatcggcatcttcgatgccggcggcgcccgcatccaggagggcgtggccgcgctc
ggcggctacggcgaggtgttccgccgcaacgtcgcggcctccggcgtgatcccgcagatc
tcggtcatcatggggccgtgcgcgggcggcgacgtctactcgccggctatgaccgacttc
atcttcatggtgcgcgacacgagctacatgttcgtgaccggccccgacgtggtgaagacc
gtcaccaacgaggtcgtgaccgccgaggaactcggcggcgccaaggtccacacctcgaaa
tcctcgatcgccgacggctcgttcgagaacgacgtcgaggcgatcctccagatccgccgc
ctgctcgacttcctgcccgccaacaacatcgagggcgtgccggagatcgagagcttcgac
gacgtcaaccgcctcgacaagtcgctcgacacgctgattccggacaacccgaacaagccc
tacgacatgggcgagctgatccgccgggtcgtggacgagggtgacttcttcgagatccag
gcggcttacgcccgcaacatcatcaccggcttcggccgcgtcgagggccgcaccgtcggt
ttcgtcgccaaccagccgctggtgctggctggcgtgctcgattcggacgcctcgcggaag
gcggcccgcttcgtgcgcttctgcaacgccttctcgatcccgatcgtcaccttcgtcgac
gtgccgggcttcctgccgggcacggcgcaggaatatggcggcctgatcaagcacggcgcc
aagctgcttttcgcctacagccaagccaccgtgccgctcgtgaccatcatcacccgcaag
gccttcggcggcgcctacgacgtcatggcctcgaagcatgtcggcgccgacctgaactat
gcgtggccgacggcgcagatcgcggtgatgggcgccaagggcgcggtcgagatcatcttc
cgcgccgagatcggcgatgcggacaagatcgccgagcggaccaaagaatacgaggaccgc
ttcctctcgcccttcgtggcggcggagcgcggctacatcgacgaggtgatcatgccccac
tccacccgcaagcggatcgcgcgggcgctcgggatgctgcgcaccaaggagatggagcag
ccctggaagaagcacgacaacatcccgctctga

DBGET integrated database retrieval system