KEGG   Methylobacterium extorquens DM4: METDI0190Help
Entry
METDI0190         CDS       T00947                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    METDI0190
  Metabolism of other amino acids
   00480 Glutathione metabolism
    METDI0190
Enzymes [BR:mdi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     METDI0190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
191947..192501
Genome map
AA seq 184 aa AA seqDB search
MTIRRRDCLAMLAVLAASRSHAAEAGPASAFAFDKPEGGGLPLSAYAGKPILVVNTATAC
GYAPQFVGLQGLWTRFGGRGLTVIAVPSPDFGNQEPLDGAAIADAARKNHGVTFPVTDKT
HVRGPAAHPFYRWAAEQKPGQSPQWNFHKYLVGRDGTLRAAFATQVDPSDPRIVSVIVAE
LGQA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgattcgccgccgcgactgcctcgcgatgctcgccgttctcgccgcgagccgctcc
catgccgcggaagctgggccggcgagcgccttcgccttcgacaagccggaggggggcggc
cttccgctttcggcctatgccggcaaacccatcctcgtggtcaacaccgccaccgcctgc
ggctacgctccgcaattcgtcggccttcaaggcctctggacccgcttcggcgggcggggc
ctgacggtgatcgcggtgccctcgcccgatttcggcaatcaggagccgctcgacggcgcc
gccatcgcggatgccgcgcgaaagaaccacggcgtgaccttcccggtcacggacaagacc
catgtgcgggggccggccgcccatccgttctaccgctgggcggccgagcagaagccgggg
cagagcccgcaatggaacttccacaagtatctcgtcggccgtgacggcaccctgcgcgcc
gccttcgcgacccaggtcgatccgagcgatccgcgcatcgtcagcgtcatcgtcgcagaa
ctgggacaggcctga

DBGET integrated database retrieval system