KEGG   Methylobacterium extorquens DM4: METDI0218Help
Entry
METDI0218         CDS       T00947                                 

Definition
cytochrome C, class I
Orthology
K08738  
cytochrome c
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    METDI0218
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    METDI0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
223331..224248
Genome map
AA seq 305 aa AA seqDB search
MDSFELNKVAGAVLGALLFAVGSGFVAELIYHPKPAGSAGYPLPEPEPKSGGAAAEAPKA
EPIAVRLASADAEKGKGGTKACQACHSFEKGGPNKVGPDLWEIVEREKAHAAGFDYSAAL
KEKGGTWTYEDLDHFLESPKGYVKGTKMAFAGIGSPTDRANVIAYLRTLADSPKPLPAAE
KKAETAPAGDKKAETEKPAEGKPDAKKAAEEKKPAGTKPVESATGDKSKTPETNAPQGNT
QSGDGKDTARPVPAPQVQPQRNEVAPTQAPEAKPSGDIPTKADPGSESTPATEPPAKPDP
DAPKP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggattccttcgagctgaacaaggttgcgggcgcggtcctgggtgccctcctgttcgcg
gttgggtcgggcttcgtggcggagctgatctatcaccccaagcccgccggaagcgccggc
tatccgctgccggagcccgagccgaagagcggcggcgccgcggcggaagcgccgaaggcc
gagcccatcgccgtgcggctcgccagcgccgatgccgagaagggcaagggcggcaccaag
gcgtgccaggcctgccacagcttcgagaagggcggcccgaacaaggtcggccccgacctc
tgggagatcgtggagcgcgagaaggcgcatgccgccggcttcgattactccgccgcgctc
aaggagaagggcggcacctggacctacgaggatctcgaccactttctcgaaagcccgaag
ggctacgtgaagggcacgaagatggcgtttgccggtatcggctcgccgacggaccgcgcc
aacgtcatcgcctatctgcgcacgctcgccgacagcccgaagccgcttccggccgccgag
aagaaggctgaaacggcgccggcgggcgacaagaaggccgagaccgagaagccggccgag
ggcaagcccgacgccaagaaggccgccgaggagaagaagccggccgggaccaagccggtg
gagagcgcgacgggcgacaagagcaagacgcccgagaccaacgcgccgcagggcaacacg
caatcgggtgacggcaaggacaccgcccgcccggtcccggcgccgcaggtccagcctcag
cgcaacgaggtcgctccgacgcaggcgcccgaggccaagccctcgggggacatcccgacc
aaggcggatccgggctccgagtcgacgccggccaccgagccgccggccaagcccgaccct
gacgcgcccaagccgtaa

DBGET integrated database retrieval system