KEGG   Methylobacterium extorquens DM4: METDI1067Help
Entry
METDI1067         CDS       T00947                                 

Gene name
cycA
Definition
cytochrome C2
Orthology
K08738  
cytochrome c
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Thiosulfate oxidation by SOX complex, thiosulfate => sulfate
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    METDI1067 (cycA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    METDI1067 (cycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
980220..980582
Genome map
AA seq 120 aa AA seqDB search
MRHLILGAALALLLPVAAHAEGDAAAGEKAFAPCKACHNFEKNGVGPTLKGVVGAKAGEG
ADGYAFSDALKKSGLTWDEANLKEWLADPKKKVPGTKMVFPGIKDPKKVDDIIAYLKTKS
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgcgtcatctcatcctcggcgccgccctcgcgctgctgctgcctgtcgccgcccatgcc
gagggcgatgccgccgccggcgagaaggcgttcgcgccctgcaaggcctgccacaatttc
gagaagaacggcgtcggcccgaccctgaagggtgtcgtcggcgcgaaggccggtgagggt
gccgacggctacgccttctccgacgcgctgaagaagtccggcctcacctgggacgaagcc
aacctcaaggagtggctcgccgacccgaagaagaaggtgcccggcaccaagatggtcttc
cccggcatcaaggacccgaagaaggtcgacgacatcatcgcctacctcaagacgaagtcc
tga

DBGET integrated database retrieval system