KEGG   Methylobacterium extorquens DM4: METDI1111Help
Entry
METDI1111         CDS       T00947                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase ruvA (EC:3.6.1.-)
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    METDI1111 (ruvA)
Enzymes [BR:mdi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     METDI1111 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1025164..1025790
Genome map
AA seq 208 aa AA seqDB search
MIGKLKGIVDSYGEDFVILDVNGVGYVVHCSARTLQRLPKPGEATDLAIETHVREDMIRL
YGFRVDAEREWFRLLQTVQGVGTRVALGVLSVLEPAQLATAIATGDKGAVARAPGVGPRL
AARLVAELKDKAPAFAPIDPALIALTGAVEDRTAPQPVADAISALVNLGYAQIQASAAIA
AALKGLGEEAGAVEAKTLIRLGLRELAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggaatcgtcgattcctacggagaggatttcgtcatcctcgac
gtgaacggcgtcggctacgtcgtccactgctccgcccgcaccctccagcgtctgccgaaa
cccggcgaggcgacggatctcgccatcgagacacatgtgcgtgaggacatgatccgcctc
tacggcttccgcgtcgatgccgagcgggagtggttccgcctgctccagacggtgcagggg
gtcggcacccgcgtggcgctcggcgtactctcggtgctggagccggcacagctcgccacc
gctatcgccaccggcgacaagggcgccgtcgcccgcgcccccggcgtcggcccgcggctc
gcggcccgcctcgtcgccgagttgaaggacaaggcgcccgccttcgcccccatcgacccg
gcgctcatcgccctgaccggcgccgtcgaggacaggaccgcgccgcaaccggtcgcggac
gcgatctcggccctggtcaatctcggctacgcccagattcaggcctcggccgccatcgcc
gccgccctgaagggcctcggcgaggaggccggggcggtggaggccaagacgctgatccgg
ctcgggctgcgggagctggcgcgatag

DBGET integrated database retrieval system