KEGG   Methylobacterium extorquens DM4: METDI1111Help
Entry
METDI1111         CDS       T00947                                 

Gene name
ruvA
Definition
(GenBank) Holliday junction ATP-dependent DNA helicase ruvA (EC:3.6.1.-)
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    METDI1111 (ruvA)
Enzymes [BR:mdi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     METDI1111 (ruvA)
DNA repair and recombination proteins [BR:mdi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     METDI1111 (ruvA)
    RecFOR pathway proteins
     METDI1111 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1025164..1025790
Genome map
AA seq 208 aa AA seqDB search
MIGKLKGIVDSYGEDFVILDVNGVGYVVHCSARTLQRLPKPGEATDLAIETHVREDMIRL
YGFRVDAEREWFRLLQTVQGVGTRVALGVLSVLEPAQLATAIATGDKGAVARAPGVGPRL
AARLVAELKDKAPAFAPIDPALIALTGAVEDRTAPQPVADAISALVNLGYAQIQASAAIA
AALKGLGEEAGAVEAKTLIRLGLRELAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatcggcaagctcaagggaatcgtcgattcctacggagaggatttcgtcatcctcgac
gtgaacggcgtcggctacgtcgtccactgctccgcccgcaccctccagcgtctgccgaaa
cccggcgaggcgacggatctcgccatcgagacacatgtgcgtgaggacatgatccgcctc
tacggcttccgcgtcgatgccgagcgggagtggttccgcctgctccagacggtgcagggg
gtcggcacccgcgtggcgctcggcgtactctcggtgctggagccggcacagctcgccacc
gctatcgccaccggcgacaagggcgccgtcgcccgcgcccccggcgtcggcccgcggctc
gcggcccgcctcgtcgccgagttgaaggacaaggcgcccgccttcgcccccatcgacccg
gcgctcatcgccctgaccggcgccgtcgaggacaggaccgcgccgcaaccggtcgcggac
gcgatctcggccctggtcaatctcggctacgcccagattcaggcctcggccgccatcgcc
gccgccctgaagggcctcggcgaggaggccggggcggtggaggccaagacgctgatccgg
ctcgggctgcgggagctggcgcgatag

DBGET integrated database retrieval system