KEGG   Methylobacterium extorquens DM4: METDI1921Help
Entry
METDI1921         CDS       T00947                                 

Definition
phosphoglycerate/bisphosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    METDI1921
   01230 Biosynthesis of amino acids
    METDI1921
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI1921
  Energy metabolism
   00680 Methane metabolism
    METDI1921
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    METDI1921
Enzymes [BR:mdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     METDI1921
Exosome [BR:mdi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   METDI1921
  Exosomal proteins of melanoma cells
   METDI1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1800884..1801237)
Genome map
AA seq 117 aa AA seqDB search
MAAPSGRTDMDSIAHTLVLVRHGQSEDNERELFSGLRDPALTARGVNEARAAGRRLKTLG
YRFDHAFTSRLQRAQHTLALILDELTEDLRAGSLAQRGRCRAATERGAPVREALSMG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaccaagcgggcggacggacatggacagcatcgcgcatactctcgtgctcgtg
cggcacggccagagcgaggataatgagcgggagctgttttcgggcttgcgagatcctgcc
ctgaccgctcgcggcgtcaacgaagcgcgtgccgccggccgtaggctgaagacgctcgga
tatcgcttcgaccacgcgttcacgagccggctccagcgtgctcagcatacgctcgcgctg
atcctcgatgaactgacggaagaccttcgcgctggctcattggcacaacgtggtcgctgc
cgtgcggcgactgagcgaggagcaccagttcgcgaagctctcagcatgggctga

DBGET integrated database retrieval system