KEGG   Methylobacterium extorquens DM4: METDI1921Help
Entry
METDI1921         CDS       T00947                                 

Definition
(GenBank) putative phosphoglycerate/bisphosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00010  Glycolysis / Gluconeogenesis
mdi00260  Glycine, serine and threonine metabolism
mdi00680  Methane metabolism
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
mdi01130  Biosynthesis of antibiotics
mdi01200  Carbon metabolism
mdi01230  Biosynthesis of amino acids
Module
mdi_M00002  Glycolysis, core module involving three-carbon compounds
mdi_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI1921
  Energy metabolism
   00680 Methane metabolism
    METDI1921
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    METDI1921
Enzymes [BR:mdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     METDI1921
Membrane trafficking [BR:mdi04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    METDI1921
Exosome [BR:mdi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   METDI1921
  Exosomal proteins of melanoma cells
   METDI1921
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAX23510
UniProt: C7CJM0
Position
complement(1800884..1801237)
Genome map
AA seq 117 aa AA seqDB search
MAAPSGRTDMDSIAHTLVLVRHGQSEDNERELFSGLRDPALTARGVNEARAAGRRLKTLG
YRFDHAFTSRLQRAQHTLALILDELTEDLRAGSLAQRGRCRAATERGAPVREALSMG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaccaagcgggcggacggacatggacagcatcgcgcatactctcgtgctcgtg
cggcacggccagagcgaggataatgagcgggagctgttttcgggcttgcgagatcctgcc
ctgaccgctcgcggcgtcaacgaagcgcgtgccgccggccgtaggctgaagacgctcgga
tatcgcttcgaccacgcgttcacgagccggctccagcgtgctcagcatacgctcgcgctg
atcctcgatgaactgacggaagaccttcgcgctggctcattggcacaacgtggtcgctgc
cgtgcggcgactgagcgaggagcaccagttcgcgaagctctcagcatgggctga

DBGET integrated database retrieval system