KEGG   Methylobacterium extorquens DM4: METDI1962Help
Entry
METDI1962         CDS       T00947                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    METDI1962 (gpmA)
   01230 Biosynthesis of amino acids
    METDI1962 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI1962 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    METDI1962 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    METDI1962 (gpmA)
Enzymes [BR:mdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     METDI1962 (gpmA)
Exosome [BR:mdi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   METDI1962 (gpmA)
  Exosomal proteins of melanoma cells
   METDI1962 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1836638..1837276)
Genome map
AA seq 212 aa AA seqDB search
MDSTTHTLVLVRHGQSEDNERELFSGLRDPALTACGVNEARAAGRRLKTLGYRFDHAFTS
RLQRAQHTLALILEELSQTDLPVHADAALNERDYGALAGLNKTEARARFGVEQVRSWRKS
SDAVPPGGESLAMTAARLWPFFERAIAPRVRSGECVLVVAHGNSLRSLLMRLDQVAPADI
EDVNIGTAEMLIYRSNTDDQTLVRAAAIACSS
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggacagcaccacacatactctcgtgctcgtgcggcacggccagagcgaggacaacgag
cgggagctgttttcaggcttgcgagatcctgccctgaccgcttgcggcgtcaacgaagcg
cgtgccgccggccgcaggctgaagacgctcggatatcgcttcgaccacgcattcacgagc
cggctccagcgtgctcagcacacgctcgccctgatccttgaggaactgagccaaaccgac
ctgcccgtgcatgcggacgcggccttgaatgaacgagactacggcgcgcttgccggtttg
aacaagacggaggctcgtgcccggttcggcgtcgagcaggtccgctcctggcggaaatct
tccgacgcggtgccgcccggcggcgagagcttggccatgacggcagcgcgcctgtggccg
ttcttcgagcgtgccatcgcacctcgcgttcgaagcggcgaatgcgtgctcgtcgtagct
cacggaaactcgctacgatccctgctcatgcgactcgatcaagtcgcccccgcagacatc
gaagatgtcaacatcggcacagcggaaatgctcatctaccgcagcaacacagatgatcaa
acgctcgtccgggccgctgcgatcgcttgttcgagttag

DBGET integrated database retrieval system