KEGG   Methylobacterium extorquens DM4: METDI2019Help
Entry
METDI2019         CDS       T00947                                 

Definition
cellulase, endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    METDI2019
Enzymes [BR:mdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     METDI2019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1894506..1895789
Genome map
AA seq 427 aa AA seqDB search
MRPPRTPRRPCRRPGFTAPRIIGWAVASALALAAAGSAAAQTTPQPASPQPASPETSSQV
PQPAPQQTEATTVPPATALPGPPRAETSARTDSGPLLANTLGDDAAWRAYRSRFITEQGR
IVDTANGLISHSEGQGYGMLLAVAAGDRPTFERIWGWTRANLMVRSDELLAWRWAPDHRP
AVSDMNNATDGDILVAWALTEAAEAWGEPSYRTAARRIAVEFGRKTILFKDPHGPVLLPA
VSGFSARERADGPLINLSYWVFPAFQRLPIVAPEYDWASLIRSGVDFLRQSRFGPSSLPT
EWISAKDSLRPADGFPPLFSYNAIRVPLYLAWAGVGRPEDYAPFKTLWGGIERERLPIVD
TRDGQPVEWLSEPGYMAISAITACAADGTPFPEALRTVQDNQNYYPATLQLLSLIAARMR
YPSCVKS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgcggcccccccgcaccccgcgccgcccttgccgccgccccggcttcaccgccccgcgt
atcatcggatgggcggttgcctcggcgctcgccctcgcggcggccggatccgccgcggca
cagacgaccccgcagccggcatccccacagccggcctccccggagacgtcgtcccaagta
cctcagcccgcgccccagcagacggaggccaccacggtgccccccgccacggccctgccg
ggcccgccgcgcgccgagacgtcggcgcggaccgattccgggccgctgctcgccaacacc
ctgggcgacgacgcggcgtggcgcgcctaccggtcgcggttcatcaccgagcagggccgg
atcgtcgataccgccaacggcctgatcagccacagcgagggccagggctacggcatgctg
ctcgcggtcgcggccggcgaccggcccaccttcgagcggatctggggctggacccgcgcc
aacctgatggtgcgctccgacgaattgctggcatggcgctgggcgcccgaccaccgcccg
gcggtctccgacatgaacaacgccaccgacggcgacatcctggtcgcctgggcgctcacc
gaggcggcggaggcctggggcgaaccctcctaccgcaccgccgcgcgccgcatcgccgtc
gagttcggccgcaagaccatcctgttcaaggacccgcacggacccgtcctgctgccggcc
gtctccggcttctcggcccgcgagcgcgccgacggcccgctcatcaacctgtcctactgg
gtcttccccgccttccagcggctgccgatcgtcgccccggaatacgattgggcctcgctg
atccgcagcggcgtcgatttcctgcgccagtcccgcttcggaccgagcagcctgccgacc
gagtggatctcggccaaggacagcttacgccccgccgacggcttcccgccgctattctcc
tacaacgcgatccgggtgccgctctatctcgcctgggccggcgtcgggcggccggaggat
tacgcgccgttcaagacgctctggggcgggatcgagcgcgagcgcctgccgatcgtcgac
acccgcgatgggcagccggtcgagtggctgagcgagccgggctatatggcgatctccgcg
atcaccgcctgcgccgcggacggaacaccctttccggaagccttaaggacggtgcaggac
aatcagaactactatcccgccaccctccaactcctctcgctgatcgccgcccggatgcgg
tatccgtcatgcgtgaaatcctga

DBGET integrated database retrieval system