KEGG   Methylobacterium extorquens DM4: METDI2306Help
Entry
METDI2306         CDS       T00947                                 

Gene name
recR
Definition
(GenBank) recombination protein recR
  KO
K06187  recombination protein RecR
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    METDI2306 (recR)
DNA repair and recombination proteins [BR:mdi03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     METDI2306 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      METDI2306 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim
Motif
Other DBs
NCBI-ProteinID: CAX23908
UniProt: C7CF84
Position
complement(2196237..2196842)
Genome map
AA seq 201 aa AA seqDB search
MPQAVAGPEIERLIQLLGRMPGLGPRSARRAALQLIKKRETLLAPLADAMRVAAERIVVC
RSCGNVDTSDPCTICRDETRDPTTLVVVEDVSDLWALERSGAVKARYHVLGGVLSALDGV
RPEHLTIARLVERAGEPGVKEIILALNATVDGQTTAHYVTESIKPFGLTVTRLAHGVPVG
GELDYLDEGTLTAAIRSRTAF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgccccaagccgtcgccggccccgagatcgagcgcctgatccagcttctcgggcgcatg
ccggggctcgggccccgctccgcccgccgggccgcgctccagctcatcaagaagcgcgag
accctgctcgcgccgctggccgacgcgatgcgtgtcgcggccgagcgcatcgtcgtgtgc
cgctcctgcggcaacgtcgataccagcgacccctgcacgatctgccgggacgagacccgc
gaccccaccaccctcgtcgtggtggaggacgtatccgatctctgggcgctggagcggtcc
ggcgcggtcaaggcgcgctaccacgtgctcggcggcgtgctctcggcgctcgacggggtg
cggccggagcacctcaccatcgcccgcctcgtggagcgggcgggcgagccgggggtgaag
gagatcatcttggcgctgaacgccaccgtcgacggccagaccacggctcactacgtcacc
gagtcgatcaagcctttcgggctgacggtcacccgcctcgcccacggcgtgcccgtcggc
ggcgagctcgattatctcgacgagggcaccctgacggcggcgatccgcagccgcacggcg
ttctga

DBGET integrated database retrieval system