KEGG   Methylobacterium extorquens DM4: METDI2312Help
Entry
METDI2312         CDS       T00947                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00020  Citrate cycle (TCA cycle)
mdi00640  Propanoate metabolism
mdi00660  C5-Branched dibasic acid metabolism
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
mdi01130  Biosynthesis of antibiotics
mdi01200  Carbon metabolism
Module
mdi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mdi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    METDI2312 (sucC)
   00640 Propanoate metabolism
    METDI2312 (sucC)
   00660 C5-Branched dibasic acid metabolism
    METDI2312 (sucC)
Enzymes [BR:mdi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     METDI2312 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAX23914
UniProt: C7CF90
Position
2204343..2205539
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLKEFGLPVSRGVPIFKPEEAAAAADELGGPVWVVKSQIHAGGRGKGTFK
GAPEGAKGGVRVTKSKDEVVQFAREMLGQTLVTVQTGEAGKQVNRLYIEEGAAIAAEFYL
SMLVDRETGRVAFVVSTEGGMDIEQVAHDTPEKIVTFSVDPATGIMPHHGRAVAKALGLS
GPQAKEAGALTEKLYAAFTAKDMSMLEINPLVLTGDGGLKCLDAKISFDSNALYRHPEIV
ALRDETEEDAKEIEASKYDLAYIALDGTIGCMVNGAGLAMATLDIIKLYGEEPANFLDVG
GGASEEKVTAAFKIITADPQVKGILVNIFGGIMKCDVIARGVIAAVKAVGLEVPLVVRLE
GTNVEEGKEIIRNSGLNVIPADDLDDAAQKIVAAVKKG
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaggccaaggctgtcctgaaggaattcggcctgccggtctcc
cgcggcgtgccgatcttcaagccggaggaggccgctgcggcggccgacgaactcggcggc
ccggtctgggtggtgaagtcgcagatccatgcgggcgggcgcggcaagggcaccttcaag
ggcgcgcccgagggcgccaagggcggtgtgcgcgtcaccaagtccaaggacgaggtggtg
cagttcgctcgcgaaatgctcgggcagacgctcgtgaccgtgcagaccggcgaggccggc
aagcaggtcaaccgcctctacatcgaggaaggcgcggcgatcgctgccgagttctacctg
tcgatgctggtcgatcgcgagaccggccgcgtcgccttcgtcgtctcgacggaaggcggc
atggatatcgagcaggtcgcccacgacacccctgagaagatcgtcaccttctcggtcgat
ccggccaccggcatcatgccccatcacggccgggccgtcgccaaggcgctcgggctctcc
gggccccaggccaaggaagcgggcgcgctcaccgagaagctctacgcggccttcacggcc
aaggacatgagcatgctggagatcaacccgctggtgctcaccggcgacggcggtctcaag
tgcctcgacgccaagatctcgttcgattcgaacgccctctaccgccaccccgagatcgtc
gcgctgcgcgacgagaccgaggaggacgccaaggagatcgaggcctcgaaatacgacctc
gcctacattgccctcgacggcaccatcggctgcatggtcaacggcgccgggctcgccatg
gcgaccctcgacatcatcaagctctacggcgaggagccggcgaacttcctcgatgtcggc
ggcggcgcctccgaggagaaggtcacggcggccttcaagatcatcaccgccgacccgcag
gtgaagggcatcctcgtcaacatcttcggcgggatcatgaagtgcgacgtcatcgcccgc
ggcgtgatcgcggcggtgaaggcggtcggcctcgaagtgccgctcgtcgtgcgcctggaa
ggcaccaacgtcgaggagggcaaggagattatccggaactccggcctcaacgtgatcccc
gcggacgatctggatgacgccgcgcagaagatcgtcgccgcggtgaagaagggttga

DBGET integrated database retrieval system