KEGG   Methylobacterium extorquens DM4: METDI2315Help
Entry
METDI2315         CDS       T00947                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    METDI2315 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    METDI2315 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    METDI2315 (sucB)
Enzymes [BR:mdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     METDI2315 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2209734..2211074
Genome map
AA seq 446 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL
VKDGETVEPGAVLGSIVEGGKGSGKSDAKPAPKSAEPAETKTQSREEKGKGEGDSKPAKE
DAPAQESSASYGSHGDAPPTDGRPADDSGPAVAKLARESGIDPASLNGSGKDGRVTKGDM
LAAIDRNGQKAPAQEARSETKAPPPRAPSAPDDAAREERVRMTKLRQTIAKRLKSAQETA
AMLTTFNDVDMGAVMAMRSQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQ
DLVYKNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKISGFGKKAREGKLSIDEMQGG
TFTITNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRNGKIEARPMMYLALSYDHRIV
DGKEAVTFLVRVKEALEDPARLVLDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgacatcctcgtccccacgctcggcgaatccgtcagtgaggccacgatcggc
cgctggttcaagaagcccggcgacacggtggccgccgacgagcccctcgtcgaactcgag
accgacaaggtcaccctcgaagtgaacgccccggccgcgggcgaactcggcgagatcctc
gtcaaggacggcgagacggtggagcccggcgcggtgctcggctcgatcgtcgagggcggc
aagggttcaggaaaatcggatgcgaagcccgctccgaagagcgccgagccggccgagacc
aagacgcagtcccgcgaggagaagggcaagggcgagggtgacagcaagcccgccaaggaa
gacgcgcccgcccaggaatcctcggcctcctacggcagccacggcgacgccccgcccacg
gacgggcgcccggccgacgacagcggcccggcggtggccaagctcgcccgcgaatccggc
atcgatccggcgagcctcaacggcagcggcaaggacggccgggtgaccaagggcgacatg
ctcgccgcgatcgacaggaacggccagaaggctccggctcaggaagcccggagcgagacg
aaggcccccccgccgcgcgccccctccgcgccggacgacgccgcgcgcgaggagcgcgtg
cggatgaccaagctgcgccagaccatcgccaagcgcctcaagagcgcccaggaaacggcg
gcgatgctgaccacgttcaacgacgtggacatgggcgcggtgatggcgatgcgctcgcag
tacaaggacatcttcgagaagaagcacgggacgaagctcggcttcatggggttcttcacc
aaggcggtgatcggcgccctcaaggacgtgccggcggtcaacgccgagatcgacgggcag
gatctcgtctacaagaactactaccacatcggcatcgcggtcggcaccgataagggcctc
gtcgtgccggtggtgcgcgacgccgacgacctctcgatcgccggcatcgagaagaagatc
tcgggcttcggcaagaaggcgcgcgagggcaagctctccatcgacgagatgcagggcggc
accttcaccatcaccaatggcggcatctacggctcgctgatgtcgaccccgatcctcaac
gcgccgcaatcgggcatcctcggcatgcaccgcatcgaggagcggccggtggtgcgcaac
ggcaagatcgaggcgcggccgatgatgtatctggcgctctcctacgatcaccgcatcgtc
gacgggaaggaggccgtgaccttcctcgttcgcgtcaaggaagccctggaggatccggcc
cgcctcgtgctggacctgtaa

DBGET integrated database retrieval system