KEGG   Methylobacterium extorquens DM4: METDI2315Help
Entry
METDI2315         CDS       T00947                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00020  Citrate cycle (TCA cycle)
mdi00310  Lysine degradation
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
mdi01130  Biosynthesis of antibiotics
mdi01200  Carbon metabolism
Module
mdi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mdi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    METDI2315 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    METDI2315 (sucB)
Enzymes [BR:mdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     METDI2315 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CAX23917
UniProt: C7CG23
Position
2209734..2211074
Genome map
AA seq 446 aa AA seqDB search
MATDILVPTLGESVSEATIGRWFKKPGDTVAADEPLVELETDKVTLEVNAPAAGELGEIL
VKDGETVEPGAVLGSIVEGGKGSGKSDAKPAPKSAEPAETKTQSREEKGKGEGDSKPAKE
DAPAQESSASYGSHGDAPPTDGRPADDSGPAVAKLARESGIDPASLNGSGKDGRVTKGDM
LAAIDRNGQKAPAQEARSETKAPPPRAPSAPDDAAREERVRMTKLRQTIAKRLKSAQETA
AMLTTFNDVDMGAVMAMRSQYKDIFEKKHGTKLGFMGFFTKAVIGALKDVPAVNAEIDGQ
DLVYKNYYHIGIAVGTDKGLVVPVVRDADDLSIAGIEKKISGFGKKAREGKLSIDEMQGG
TFTITNGGIYGSLMSTPILNAPQSGILGMHRIEERPVVRNGKIEARPMMYLALSYDHRIV
DGKEAVTFLVRVKEALEDPARLVLDL
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgacatcctcgtccccacgctcggcgaatccgtcagtgaggccacgatcggc
cgctggttcaagaagcccggcgacacggtggccgccgacgagcccctcgtcgaactcgag
accgacaaggtcaccctcgaagtgaacgccccggccgcgggcgaactcggcgagatcctc
gtcaaggacggcgagacggtggagcccggcgcggtgctcggctcgatcgtcgagggcggc
aagggttcaggaaaatcggatgcgaagcccgctccgaagagcgccgagccggccgagacc
aagacgcagtcccgcgaggagaagggcaagggcgagggtgacagcaagcccgccaaggaa
gacgcgcccgcccaggaatcctcggcctcctacggcagccacggcgacgccccgcccacg
gacgggcgcccggccgacgacagcggcccggcggtggccaagctcgcccgcgaatccggc
atcgatccggcgagcctcaacggcagcggcaaggacggccgggtgaccaagggcgacatg
ctcgccgcgatcgacaggaacggccagaaggctccggctcaggaagcccggagcgagacg
aaggcccccccgccgcgcgccccctccgcgccggacgacgccgcgcgcgaggagcgcgtg
cggatgaccaagctgcgccagaccatcgccaagcgcctcaagagcgcccaggaaacggcg
gcgatgctgaccacgttcaacgacgtggacatgggcgcggtgatggcgatgcgctcgcag
tacaaggacatcttcgagaagaagcacgggacgaagctcggcttcatggggttcttcacc
aaggcggtgatcggcgccctcaaggacgtgccggcggtcaacgccgagatcgacgggcag
gatctcgtctacaagaactactaccacatcggcatcgcggtcggcaccgataagggcctc
gtcgtgccggtggtgcgcgacgccgacgacctctcgatcgccggcatcgagaagaagatc
tcgggcttcggcaagaaggcgcgcgagggcaagctctccatcgacgagatgcagggcggc
accttcaccatcaccaatggcggcatctacggctcgctgatgtcgaccccgatcctcaac
gcgccgcaatcgggcatcctcggcatgcaccgcatcgaggagcggccggtggtgcgcaac
ggcaagatcgaggcgcggccgatgatgtatctggcgctctcctacgatcaccgcatcgtc
gacgggaaggaggccgtgaccttcctcgttcgcgtcaaggaagccctggaggatccggcc
cgcctcgtgctggacctgtaa

DBGET integrated database retrieval system