KEGG   Methylobacterium extorquens DM4: METDI2672Help
Entry
METDI2672         CDS       T00947                                 

Definition
bifunctional enzyme, phosphoglycerate mutase and PLP-dependent aminotransferase domains (EC:2.3.1.47 5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:mdi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mdi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mdi00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:mdi00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mdi00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2577327..2578331)
Genome map
AA seq 334 aa AA seqDB search
MAPSYQTSVNKKPFVTEVVRSRRGRKSSLAVSSFAPSVERGAGVLVLVRHGESEFNKQDR
FTGLKDPPLTSNGVREAIEVGRTLQASGFHYDVAFTSELKRAQQSLQLILRELHARSVPV
FNEAALNERNYGELAGMTRDAARARWGEERVAQWRRSYDVAPPGGESLAMTAGRTLPFFD
ERIRPLLSLGKRVLVVAHGNSLRSIVMSLDIFATAPSPLTAVAVREALLILQEEPDRQQR
LTNLVAFTHREIGAYGGWRPSGSQILPYIVGENARAMTLASALQARGFDIRGIRPPTVPA
GTARLRISLTLNVGKDDIRAMLNAVIEETRGDAR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggctccatcgtatcaaacgtctgtcaacaagaagcctttcgtcactgaggtagtccgt
tctcgaaggggtcgtaagtcgtccttggccgtctcctcgtttgcgccttctgtcgagcgg
ggagctggcgtcctagtgctggtcaggcacggcgaaagcgagtttaacaagcaggatcgc
ttcaccgggttgaaggacccgccactgacctcgaatggggtgcgagaagcaattgaggtc
ggccgcacccttcaagcgagcggctttcactacgatgtcgcattcacaagcgaacttaaa
cgagcccaacaatcgctccagctcatcctccgggagcttcatgcaagatcagttccggtc
tttaatgaggctgcgctgaacgagcgaaattacggcgagctcgcgggaatgactcgagac
gccgcgcgtgcgcgttggggcgaggaacgtgtcgcccagtggcggcgatcctatgacgtc
gcgccgcccggcggcgaaagcctcgcaatgaccgccggtaggacgctgccctttttcgat
gaacgcatccggccgcttctctcgcttggaaagcgagttctcgtcgtagctcacgggaat
tcattgcgttcgatcgtgatgtcgcttgatattttcgccaccgcgccgtcacctttgaca
gccgtcgcagtgcgggaggcgctattgatcctgcaggaggaaccggaccggcagcaacgt
ttgaccaacctggtcgcgttcacgcatcgggagatcggcgcgtatgggggctggcgtccc
tcaggctcgcagatcctgccatatatcgttggcgaaaacgcgcgtgcgatgacgctggca
tccgcgctgcaggctcgcggattcgatatccgtggaatacggccgccgaccgtgccggcg
ggcacggcgcggctgcgaatttccctgacacttaacgtcgggaaggatgacatccgtgcc
atgctcaatgccgtgatcgaggagacaagaggcgacgctcgatga

DBGET integrated database retrieval system