KEGG   Methylobacterium extorquens DM4: METDI2672Help
Entry
METDI2672         CDS       T00947                                 

Definition
bifunctional enzyme, phosphoglycerate mutase and PLP-dependent aminotransferase domains (EC:2.3.1.47 5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    METDI2672
   01230 Biosynthesis of amino acids
    METDI2672
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI2672
  Energy metabolism
   00680 Methane metabolism
    METDI2672
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    METDI2672
Enzymes [BR:mdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     METDI2672
Exosome [BR:mdi04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   METDI2672
  Exosomal proteins of melanoma cells
   METDI2672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2577327..2578331)
Genome map
AA seq 334 aa AA seqDB search
MAPSYQTSVNKKPFVTEVVRSRRGRKSSLAVSSFAPSVERGAGVLVLVRHGESEFNKQDR
FTGLKDPPLTSNGVREAIEVGRTLQASGFHYDVAFTSELKRAQQSLQLILRELHARSVPV
FNEAALNERNYGELAGMTRDAARARWGEERVAQWRRSYDVAPPGGESLAMTAGRTLPFFD
ERIRPLLSLGKRVLVVAHGNSLRSIVMSLDIFATAPSPLTAVAVREALLILQEEPDRQQR
LTNLVAFTHREIGAYGGWRPSGSQILPYIVGENARAMTLASALQARGFDIRGIRPPTVPA
GTARLRISLTLNVGKDDIRAMLNAVIEETRGDAR
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
gtggctccatcgtatcaaacgtctgtcaacaagaagcctttcgtcactgaggtagtccgt
tctcgaaggggtcgtaagtcgtccttggccgtctcctcgtttgcgccttctgtcgagcgg
ggagctggcgtcctagtgctggtcaggcacggcgaaagcgagtttaacaagcaggatcgc
ttcaccgggttgaaggacccgccactgacctcgaatggggtgcgagaagcaattgaggtc
ggccgcacccttcaagcgagcggctttcactacgatgtcgcattcacaagcgaacttaaa
cgagcccaacaatcgctccagctcatcctccgggagcttcatgcaagatcagttccggtc
tttaatgaggctgcgctgaacgagcgaaattacggcgagctcgcgggaatgactcgagac
gccgcgcgtgcgcgttggggcgaggaacgtgtcgcccagtggcggcgatcctatgacgtc
gcgccgcccggcggcgaaagcctcgcaatgaccgccggtaggacgctgccctttttcgat
gaacgcatccggccgcttctctcgcttggaaagcgagttctcgtcgtagctcacgggaat
tcattgcgttcgatcgtgatgtcgcttgatattttcgccaccgcgccgtcacctttgaca
gccgtcgcagtgcgggaggcgctattgatcctgcaggaggaaccggaccggcagcaacgt
ttgaccaacctggtcgcgttcacgcatcgggagatcggcgcgtatgggggctggcgtccc
tcaggctcgcagatcctgccatatatcgttggcgaaaacgcgcgtgcgatgacgctggca
tccgcgctgcaggctcgcggattcgatatccgtggaatacggccgccgaccgtgccggcg
ggcacggcgcggctgcgaatttccctgacacttaacgtcgggaaggatgacatccgtgcc
atgctcaatgccgtgatcgaggagacaagaggcgacgctcgatga

DBGET integrated database retrieval system