KEGG   Methylobacterium extorquens DM4: METDI2701Help
Entry
METDI2701         CDS       T00947                                 

Definition
dihydroflavonol-4-reductase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
mdi  Methylobacterium extorquens DM4
Brite
Enzymes [BR:mdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     METDI2701
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2606285..2607328
Genome map
AA seq 347 aa AA seqDB search
MNRASTMTEPTQSGPFPAGPVLITGASGFLGAALVDVFRAAGFRVRITVRASSPRTNLIW
PDVEIVEADMRDRAAVASAMRGQRYLVHAAADYRLWAPDMEEIVRTNRDGTRILMEEALK
AGVERIVYTSSVATIKPHDDGTPADETRPLTPETAIGAYKRSKVVAERVVDEMVARDGLP
AVIVNPSTPIGPRDVKPTPTGRIILDAAQGKIPAFVDTGLNLAHVDDVAAGHLLALRKGR
IGEHYILGGEDVMLAQMLADIAAIVGRKAPTTRLPYAVIYPIAFISEQIARVTGKAPLAT
IDGVRMSKYRMFFSDAKARAELGYSARPYRRGLEDAIAWFRQAGYMK
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcgcgcgagcacgatgacagagccgacccaaagcggcccgttcccagcggggccg
gtgttgatcaccggtgccagcggcttcctcggagccgccctggtggacgtcttccgcgcg
gccggcttccgcgtgcgcatcaccgtgcgcgcctcctcgccccgcaccaacctgatctgg
cccgatgtcgagatcgtcgaggccgacatgcgcgaccgggcggcggtggcgagcgccatg
cgcggccagcgctacctcgtccacgccgcggccgattaccggctttgggcgccggacatg
gaggagatcgtccgcaccaaccgcgacggcacgcgcatcctgatggaggaggcgctcaag
gccggtgtggagcggatcgtctacacatcgagcgttgcgaccatcaaaccgcacgacgac
ggcacccccgcggacgagacccggccgctgacgccggagaccgccatcggcgcctacaag
cgcagtaaggtcgtggccgagcgcgtggtcgacgagatggtggcccgtgacggcctgccc
gccgtcatcgtgaacccctcgacgccgatcggcccgcgcgacgtgaagccgacgccgacc
ggccgcatcatcctcgacgcggcgcagggcaagatcccggccttcgtcgataccggcctc
aacctcgcccatgtcgacgacgtggctgcgggccatttgctggccctgcgcaagggccgg
atcggcgagcactacattctcggcggcgaggatgtgatgctggcgcaaatgctcgccgac
atcgccgccatcgtcggccgcaaggcgccgacgacgcggctgccctacgccgtgatctac
ccgatcgccttcatctccgagcagatcgcgcgggtgaccggcaaggcgccgctcgccacc
atcgatggcgtgcgcatgtcgaagtaccggatgttcttctccgacgccaaggcgcgggcg
gaactcggctattccgcgcggccctaccgccggggccttgaggatgccatcgcgtggttc
cgtcaggcggggtacatgaaatga

DBGET integrated database retrieval system