KEGG   Methylobacterium extorquens DM4: METDI2766Help
Entry
METDI2766         CDS       T00947                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase (GMP kinase)
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00230  Purine metabolism
mdi01100  Metabolic pathways
Module
mdi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    METDI2766 (gmk)
Enzymes [BR:mdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     METDI2766 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 TsaE AAA_18 AAA ABC_tran AAA_22 CPT cobW AAA_30 DUF3619
Motif
Other DBs
NCBI-ProteinID: CAX24424
UniProt: C7CIU4
Position
2676509..2677180
Genome map
AA seq 223 aa AA seqDB search
MTQDATQGRPDIARRGLILILSSPSGAGKTTLTRAIAQRPEWGLDLSISVTTRSRRPSEI
DGRDYRFIDREAFEDLRTRDDLLEWAEVHGNFYGTPRRPVEKTLSQGRDMIFDIDYQGTR
QVRQRLQDDVVTVFILPPSFAELRNRLERRAEDAPETIERRLANARNEMQRWSEYDYVIV
NDDLDESFRALQSILAAERLKRTRRTGLPGFVDGLLAEAGRSA
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaggatgccacccaaggcagaccggatatcgcccggcgcgggctgatcctgatc
ctgtcctcgccctcgggcgcgggcaagacgacgctgacccgcgccatcgcccagcggcct
gaatggggcctcgacctgtcgatctcggtgacgacgcgctcgcgccgcccctcggagatc
gacgggcgcgactaccgcttcatcgaccgcgaggcgttcgaggatcttcgcacccgcgac
gacctgctcgaatgggccgaggtccacgggaatttctacggcacgccgcgccgcccggtc
gagaagaccctgtcccaaggccgggacatgatcttcgacatcgactaccagggcacccgc
caagtccggcagcggctgcaggacgacgtggtgacggtgttcatcttgccgccgagcttt
gccgagttgcgcaaccgcttggagcgccgggcggaagacgcaccggagacgatcgagcgg
cggctggccaacgcccgcaacgagatgcagcgctggagcgagtacgactacgtcatcgtc
aacgacgacctcgacgagtccttccgcgcgcttcaatcgatcctggccgccgagcgcctc
aagcgcacccgccgcaccggcctgccgggcttcgtcgatgggctcctggccgaggccggg
cggagcgcttga

DBGET integrated database retrieval system