KEGG   Methylobacterium extorquens DM4: METDI3474Help
Entry
METDI3474         CDS       T00947                                 

Definition
malto-oligosyltrehalose synthase (EC:2.4.1.25 5.4.99.15)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
K06044  
(1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase [EC:5.4.99.15]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    METDI3474
Enzymes [BR:mdi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     METDI3474
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.15  (1->4)-alpha-D-glucan 1-alpha-D-glucosylmutase
     METDI3474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3396508..3401433
Genome map
AA seq 1641 aa AA seqDB search
MSASNVSDLERLADLVGIADGFTDAFGKRVDTPLDVRRGMLEALGFAAGDDEAIRRSLAA
VEAVRANVIPPLLAAEARRGVRVPVRMGVTSGAVAWRLVDEHDRSREGRATLTASEEGAG
FDLPPLTPGYHRLTVTVGDSRAQAWIVSAPQRCWRPRAYAEDGARDWGLAAQLYGLRSPS
NLGIGTYADAGRAARDAALRGASFLGLSPAHALFPTDRAKISPYSPSSRLFLETLYIEPG
ALPGFAGSRAAEILESQRVRIETLRDISLVDHAGVWEVLSPILEAYWEDSDARAGKDAGF
AAFREEGGENLTSHATFDALSEHFRTKGAHWLGDWPEEYRRAGTDAVRAFSETHADRIRY
HIFLQYLADTQLKASSEMALAAGMRLGLYRDLAVGADRGGSEIWSHPERFANGVSIGAPP
DLLAPKGQDWGLPAFDPLEMERDGLKAFRALVRANMRHAGAIRIDHAFQLARLFLIPLGR
SAREGAYVAMPFEPMLAVLRLESHRAKCLVIAEDLGTAPEGFSDALMQSGILSYRILAFE
REQGGAFKAPEAYPKDALTAITTHDLPTFVGWWRGVDTDTRQSLGLYDAERAEAERTERV
AERWRLSEALAAQQLLPSSEPPEHAPLEAAARYLARAPSILTAVQYEDVVGELSQANVPG
STEGYPNWRRKLDRNLEAIAAPGGPLAKLAAALSAEERGPRSGAARLASAPPRATYRLQF
HEGFTFADAEKTVPYLQKLGISHVYASPLQRARPGSTHGYDIVDHSQINPEIGGEEGFRS
FTDALHAHGLKLLLDIVPNHMGVGGADNPWWLSVLEWGGLSPAANAFDIDWERLGANGKL
VIPFLGERYGEALEKGTLELKFDEAAGAFSVWHYEHQFPICPLQYPTILNRALAALGEIG
DDMSAEVLAITERLRAMGEETNLERRRAMPEAAEELKRQLAGTVRASPQIAASIYRALHL
LNGNRDYPDSFGPLHRLLEQQSYRLAHWRIASSDINYRRFFDVNSLAGLRVELSDVFVRS
HDLLFRLIGEGRIDGLRIDHIDGLADPLGYARALQAAVGPGFYIVVEKILEPGEKLRDWP
VAGTTGYDVLNQLDGILVDRALKPRIEKFYRWATDMDTPYGFQFRAAKAEILEISFASEL
EVMTGDLKQIADSDRRTRDFSTNAIRRALIEIVARFPVYRSYLPGDLDETEIEAEDVRLI
EGAVRKAKRWSALPDRSVHDFAADALLGRTDLGSAGHPDQQVVLRFRRRFQQLTGPVMAK
SLEDTLFYRFVELLGLNEVGGDPGEYGLDAEHFHALQAARARDWPNAMITTATHDTKRGE
DARTRQLALSELPEEWARAWDTWRRASEPLIKQVEGEPAPDPNDQWMFLQAILGAWPLEL
LDGDDPGAIEDFRKRLDAYAEKALRESKRRSSWVNVDEGYESAVHALFAALVVPGSDCLD
RLRPLVRRLAFLGMIAGLGRTVLKCTLPGIPDTYQGTEFWDFSFVDPDNRRPVDYAERAR
ALEAGGTPDALIGSWQDGRVKQATLARLLADRAARPAFYADADYRPLPAEGARADHVIAF
TRSAVTSGEDDLLVAVPRLVARMTPESGWSSEAFAGTVLPVPAGSRWVDVVGGGEITAEG
DGLDLGRHFAKLPYLVLRRAT
NT seq 4926 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgcctcgaacgtgagtgatctcgaacgcctcgccgacctcgtcggcatcgccgac
ggcttcaccgatgctttcgggaagcgggtcgatacgcctctcgatgtgcgccgcggcatg
ctcgaagccctcggattcgcggcgggggacgacgaagcgatccgccgcagcctcgccgcg
gtcgaggcggtgcgtgccaatgtgatcccaccgcttctggcggccgaggcacggcgcggc
gtgcgcgtgccggtgcggatgggcgtgacctccggcgccgtggcgtggcggctggtggat
gagcacgaccgctcccgtgagggacgggccaccctgaccgcgtcggaagaaggggccggg
ttcgacctgccgccgctgacgccgggctatcaccggctcaccgtcacggtcggcgacagc
cgggcccaggcctggatcgtctccgcaccgcagcgctgctggcgcccgcgtgcctatgcc
gaggacggcgcccgcgattggggtctcgccgcccagctctacggcctgcgctcgccgagc
aacctcggcatcggcacctacgcggatgccggccgtgccgcccgtgatgcggctttgcgc
ggcgcctcgttcctcgggctcagccctgcccacgccctgttccccaccgaccgggcgaag
atctccccctattcgccgtcctcgcgcctcttcctcgaaaccctctacatcgaaccgggc
gcgctgccgggcttcgccgggagccgcgccgccgagatcttggaaagccagcgcgtccgc
atcgagacgctgcgcgacatctccctcgtcgatcatgccggcgtctgggaggtgctctcg
cccatcctcgaagcctattgggaggattccgatgcccgagccggcaaggatgccggcttc
gcggcgttccgcgaggaaggcggcgagaacctcacgtcacacgccaccttcgacgcgctc
tcagaacatttccggaccaagggcgcgcactggctcggcgactggccggaagagtaccgc
cgcgccggtaccgacgccgtgcgagccttctccgagacgcatgcggaccgcatccgctat
cacatcttcctgcaatacctcgccgacacccagctcaaggcctcctccgagatggcgctg
gccgccggcatgcggcttggcctctatcgcgatctggcagtcggcgcggaccggggcggc
tcggagatctggtcgcatcccgagcgcttcgccaacggtgtctccatcggtgcgccgccg
gatctgctcgcccccaagggccaggattggggcctgccggccttcgatccgctggagatg
gagcgcgacggcctgaaagccttccgggcgctggtgagagcgaacatgcgccatgccggc
gcgatccgcatcgaccacgcgtttcagctcgcgcgcctgttcctgatcccgctcgggcgg
tcggcccgcgagggtgcgtatgtcgcgatgccattcgagccgatgctcgccgtgctgcgg
ctcgagagccaccgcgccaagtgcctcgtcatcgccgaggatctcggcaccgcaccggag
ggcttctccgatgcgctgatgcagtccggcatcctcagctaccgcatcctggccttcgag
cgggagcagggcggtgccttcaaggcgcccgaggcctatcccaaggatgcgctgaccgcg
atcaccacccatgacctgccgacctttgtcggctggtggcgcggcgtcgataccgacacc
cggcaatctttgggcctctacgacgccgagcgcgccgaggccgaacgcaccgagcgcgtc
gccgagcgttggcgcctgtcggaggcgctggcggcccagcagctcctgccgagctccgag
ccgccggaacacgcaccgctcgaggcagcggcccgctatctcgcccgcgcgccatcgatc
ctgaccgccgtgcagtacgaagacgtcgtcggcgagctgtcgcaggccaacgtgcccggt
tcgaccgagggctatccgaactggcggcgcaagctcgaccgcaacctcgaagccatcgcc
gcccccggcgggccgctcgccaagctcgccgccgcgctgtcggcggaagaacgcggtccg
cgctcgggcgccgcacgcctcgcctcggccccgccgcgggcgacctaccgcctccagttc
cacgaaggcttcaccttcgcggatgcggagaagacggtcccttatctgcagaagctcggc
atcagccacgtctacgcgtcgccgctccagcgggcacggccgggctcgacccacggctac
gacatcgtcgatcactcccagatcaatccggagatcggcggcgaagagggtttccgcagc
ttcaccgacgcgctccacgcccatggcctgaagctgcttctcgacatcgtgcccaaccac
atgggtgtgggtggcgccgacaatccgtggtggctctcggtgctcgaatggggcggactc
tcgcctgcggccaatgccttcgacatcgattgggagcggctcggcgccaacggcaagctc
gtcatccccttcctcggcgagcgttacggcgaggctctggagaagggcacgctggagctg
aaattcgacgaggcggccggcgccttcagcgtctggcactacgagcatcaattcccgatc
tgcccgctgcaatacccgacgatcctcaaccgggcgctcgcggcgctcggcgagatcggc
gacgacatgtcggcggaggttctggcgatcaccgagcgtctgcgggccatgggtgaggag
accaatctcgagcgccgccgcgccatgccggaggccgccgaggaactgaagcgtcagctt
gcaggcaccgtgcgggcctcgccgcagatcgccgcctcgatctaccgggcgctgcatctc
ctcaacggcaaccgggactatcccgacagcttcgggccgctgcatcggctgctcgaacag
caatcctaccgtctcgcccattggcggatcgcgtcgagcgacatcaactaccgccgcttc
ttcgacgtgaactcgctggccggcctgcgcgtcgagctgtcggacgtgtttgtccgctcg
cacgatctgctgttccgcctcatcggcgaaggccggatcgacggcttgcgcatcgaccac
atcgacgggctggccgatccgctgggctacgcccgtgcgctccaggccgcggtcggtccc
ggcttctacatcgtcgtcgagaagatcctggagccgggcgagaagctgcgcgactggccg
gtcgccggcaccaccggctacgacgtgctgaaccagctcgacggcatcctggtcgatcgc
gccctgaagccgcgtatcgagaagttctatcggtgggccaccgatatggacacgccctac
ggcttccaattccgcgcggccaaggcggagattcttgagatcagcttcgcctcggaactc
gaggtgatgaccggcgacctcaagcagatcgccgattccgaccggcgcacccgcgacttc
tccaccaacgcgatccgtcgggcgctgatcgagatcgtggcgcgcttccccgtctatcgc
tcctacttgcccggtgatctcgacgagacggagatagaggccgaggatgtgcgactgatc
gagggcgccgtgcgcaaggccaagcgctggagcgcgctaccggatcgttcggtgcacgac
tttgctgccgatgccctgctcggccggaccgatctcggctctgccggtcacccggatcag
caggtggtcctgcgcttccgccgccggttccagcagctcaccggcccggtgatggccaag
agcctggaagacacgttgttctatcgcttcgtcgaactgctcggcctcaacgaggtcggc
ggcgatcccggcgagtacggcctcgacgcggagcacttccacgcgcttcaggcggcgcgc
gcccgcgactggccgaacgcgatgatcaccacggccacccatgacaccaagcgcggtgag
gatgcccgcacgcgccagctcgccctctccgagctgccggaggaatgggcccgcgcctgg
gacacgtggcgccgcgcctccgagccgctgatcaagcaggtcgaaggcgagccggcaccg
gacccgaacgaccagtggatgttcctgcaggcgattctcggcgcgtggccgctcgagctt
ctggacggtgacgacccgggcgcgatcgaagacttccgcaagcgcctcgacgcctatgcc
gagaaggctctgcgcgaaagcaagcgccggtcgagctgggttaacgtcgacgaaggttac
gagagcgccgtccacgcgctcttcgcggccctggtcgtgcccggctcggattgcctcgat
cggctccggccgctcgtccgtcgccttgccttccttggcatgatcgctggactcgggcgc
acggtgctcaaatgcacccttcccggcattccggacacgtatcagggcaccgagttctgg
gacttctcgttcgtcgatcccgacaaccgtcggcctgtcgattacgcggaacgggcccgg
gcgctggaggccggcggcacgccggacgcgttgatcggttcctggcaggacggacgcgtg
aaacaggcgacgttggcgcggttgctcgccgaccgggcggcgcgcccggccttctacgcc
gacgcggattaccgtccgctcccggccgaaggtgcgcgtgcggatcacgtcatcgcgttt
acccgctcggccgtcacttcgggtgaggacgatctgttggtcgccgtgccgaggctcgtc
gcacggatgacgcccgaatcaggttggtccagcgaagccttcgccggaaccgtcctcccc
gtaccggccggcagccggtgggtggacgtggtcggcggcggcgagatcacggcggagggc
gacgggctcgacctcggtcggcacttcgcgaaactgccctatctggtgttgcggcgggct
acctga

DBGET integrated database retrieval system