KEGG   Methylobacterium extorquens DM4: METDI3781Help
Entry
METDI3781         CDS       T00947                                 

Gene name
bchD
Definition
magnesium chelatase subunit BchD (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    METDI3781 (bchD)
Enzymes [BR:mdi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     METDI3781 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3721299..3723047
Genome map
AA seq 582 aa AA seqDB search
MAPETDDPAGVWNDALYAATLFAADPHGLGGIVLRAGAGPVRDLWLDHLRDRLTGPVRRM
PPGIADDRLIGGLDLPATLRAGRPVIQRGLLAEADGGVVVVPMAERLERGTVARLAGALD
TGLLVLERDGLAARLPARFGLVLLDEGQEDETVAEALSDRMALHLDLSGVSLRDARTAPS
HTARGADAAAGPPAPDATATLCAVAEAFGIASLRAPLLALRIARLIAGEAGRDEPNEADL
IEAARLVLAPRATRLPAPPQPGEPEPADPPPPEPQPPQDADRPPEDAAERADATPREADE
TVLDAVRAALPKDLLARLLAGGPPLRAGAAGRMGVASASPLAGRPVGSRPGDPRRGRLDL
IATLRAAAPWQRLRRGEADPRRVLVTPEDFRIRRLKQRSETTTIFCVDASGSAALERLAE
AKGAVELLLAEAYVRRDRIALVAFRGARAETVLPPTRSLVRAKRALAGLPGGGGTPLAAG
LDTAAALALGIRRAGGSPVIVLLTDGRANVARSGLGGRALAGEEALAAARVLRVQALPIL
VIDTGARPDGARGLAEAAQGRYCPLPHADAGSVSAAVRAATA
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atggccccggagaccgacgatccggccggggtttggaacgatgcgctctacgccgccacg
ctgttcgccgccgacccgcacggtctcggcgggatcgtgctgcgcgccggggccggtccg
gtgcgcgacctctggctcgatcatctccgcgacaggctgacgggcccggtgcggcggatg
ccgccgggaatcgccgacgaccgtctgatcggcgggctcgacctgcccgccaccctgcgg
gccggccgtccggtgatccagcgcggcctgctggcggaggccgatggcggtgtcgtcgtg
gtgccgatggctgaacgcctggagcgcggcaccgtggcccggctcgcgggcgccctcgac
acgggcctgctggtgctggaacgtgatggcctcgccgcacggctcccggcccgcttcggc
ctcgtgctgctcgacgaggggcaggaggacgagaccgtcgccgaggcgctctccgaccga
atggcactccacctcgacctgtccggcgtgagcctgcgggacgcgagaaccgccccttcc
cataccgctcgcggagcggacgccgcggcaggcccacccgcgcccgacgcgaccgccacc
ctctgcgccgtggcggaggccttcggcatcgcctcgctgcgggcgccgcttctcgccctg
cgcatcgcccggctcatcgccggggaggccgggcgcgacgaaccgaacgaggccgacctg
atcgaagccgcacgtctcgtcctggcgccgcgggcgacgcgcctgcccgcgccgccgcaa
ccgggcgagccggaaccggcggatccgcccccgccggagccgcagcccccacaggacgcc
gatcgcccccctgaggacgcggccgagcgggcggatgccacgccgagagaagccgacgag
acggtgctcgacgcggtccgtgccgccctcccgaaggacttgctcgcccggctgctggcc
ggtggcccgccgctgcgcgccggcgcggccgggcggatgggggtggcctccgcctcgccg
ctcgcgggccgcccggtcggcagccgtcccggcgatccgcgccggggccggctcgacctg
atcgcgaccctgcgcgccgccgccccgtggcagcgcctgcgccggggcgaggccgatccg
cgccgcgtcctggtcaccccggaggatttccggattcgccggctgaagcagcgcagcgag
acgacgacgatcttctgcgtcgatgcctccggctcggcggcgctcgaacggctggcggaa
gcgaagggcgccgtcgaactgctcctcgccgaggcttacgtccggcgcgaccgcatcgcc
ctcgtcgccttccgcggcgcgcgggccgagacggtgctgccgccgacgcgctcgctggtc
agggccaagcgcgcgctcgcgggcctccccggcggaggcggcacgccgctcgccgccggg
ctcgacaccgccgccgccctggccctcggcatccggcgcgcgggcggaagccccgtcatc
gtcctgctcaccgacgggcgcgccaacgtcgcccgctccggcctcggcggccgggcgctg
gccggcgaagaggctttggccgccgcccgcgtgctccgggtgcaggcgctgcccattctc
gtgatcgataccggcgcccggcccgacggggcgcgcggcctcgccgaggcggcgcagggg
cgttactgtccgctgccccatgccgatgcgggcagcgtcagcgcggcggtgcgcgccgcc
acagcctga

DBGET integrated database retrieval system