KEGG   Methylobacterium extorquens DM4: METDI3838Help
Entry
METDI3838         CDS       T00947                                 

Definition
(GenBank) putative diguanylate cyclase (GGDEF motif)
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mdi  Methylobacterium extorquens DM4
Brite
Enzymes [BR:mdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     METDI3838
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3769561..3770619)
Genome map
AA seq 352 aa AA seqDB search
MQGQMQQADPDLDRALAPAHRAWEALRQYALPPSPRNYELLHTFFAGANPPLSERLAACL
APGGTLTEEQASALYDACIAGTATEASVLDGAGRLAEAAGTLAERVAGSRKALAGYGDAL
THWSGRLNARPTADELMTALVALIGETEQAQTRNHLLEEQLSVSAAHIAKLHKDLVETQR
AAATDALTGLANRKTFDGFLRDSIARTRSDSGSTFSLLMLDIDHFKGLNDRHGHRFGDQV
LRLVGRLLSAKTTDRDLAARYGGEEFAIVLGEAGIGAGVALAQEICGRLRGQRLVKRGTG
DVVAQVTISAGVAQYRPGEAARDVIERADRALYEAKRTGRDRVCPTPRAAVA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcagggacagatgcagcaggcggatccggacctcgaccgcgctctggctcccgcgcac
cgcgcctgggaagcgctgcggcagtatgcgctgccgccctccccgcggaactacgaattg
ctgcacaccttcttcgccggcgccaatccgccgctgagcgaacgcctcgcggcctgtctg
gcacccggtggaacgctgaccgaagagcaggcgagcgcgctctacgatgcctgcatcgcc
gggaccgcgacagaggcctccgtgctcgatggggcgggccggctggcggaggcggccggt
accctggccgagcgcgtcgcgggcagtcggaaggcgctcgccggctatggtgatgccctg
acccattggtccggccgcctgaatgcacggccgaccgccgatgagctgatgacggcgctc
gtcgccctgatcggcgagaccgagcaggcgcagacccgcaaccacctgctcgaggagcag
ctctcggtctccgccgcccacatcgccaagctgcacaaggatctcgtcgagacgcagcgc
gcggcggcgaccgatgccctgacggggcttgccaaccgcaagacctttgacggcttcctg
cgcgactcgatcgcccggacccggagcgattccggcagcaccttctcgctgctcatgctc
gacatcgaccacttcaagggtctcaacgaccggcacggccaccgcttcggcgatcaggtg
ctgcgcctcgtcggacggctgctcagcgcgaagacgacggatcgcgacctcgccgcgcgc
tacggcggcgaggaattcgcgatcgtgctcggcgaggccggcatcggcgccggcgtcgcg
ctcgcccaggagatctgcggccggctgcggggtcagcggctggtcaagcgcggcaccggt
gatgtcgtggcacaggtcacgatctcggccggcgtcgcacagtaccgaccgggtgaagcc
gcccgcgatgtgatcgagcgggccgaccgcgcgctctacgaggccaagcggaccggccgc
gaccgcgtctgcccgacgccgcgggccgcggtcgcgtga

DBGET integrated database retrieval system