KEGG   Methylobacterium extorquens DM4: METDI3838Help
Entry
METDI3838         CDS       T00947                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mdi  Methylobacterium extorquens DM4
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3769561..3770619)
Genome map
AA seq 352 aa AA seqDB search
MQGQMQQADPDLDRALAPAHRAWEALRQYALPPSPRNYELLHTFFAGANPPLSERLAACL
APGGTLTEEQASALYDACIAGTATEASVLDGAGRLAEAAGTLAERVAGSRKALAGYGDAL
THWSGRLNARPTADELMTALVALIGETEQAQTRNHLLEEQLSVSAAHIAKLHKDLVETQR
AAATDALTGLANRKTFDGFLRDSIARTRSDSGSTFSLLMLDIDHFKGLNDRHGHRFGDQV
LRLVGRLLSAKTTDRDLAARYGGEEFAIVLGEAGIGAGVALAQEICGRLRGQRLVKRGTG
DVVAQVTISAGVAQYRPGEAARDVIERADRALYEAKRTGRDRVCPTPRAAVA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcagggacagatgcagcaggcggatccggacctcgaccgcgctctggctcccgcgcac
cgcgcctgggaagcgctgcggcagtatgcgctgccgccctccccgcggaactacgaattg
ctgcacaccttcttcgccggcgccaatccgccgctgagcgaacgcctcgcggcctgtctg
gcacccggtggaacgctgaccgaagagcaggcgagcgcgctctacgatgcctgcatcgcc
gggaccgcgacagaggcctccgtgctcgatggggcgggccggctggcggaggcggccggt
accctggccgagcgcgtcgcgggcagtcggaaggcgctcgccggctatggtgatgccctg
acccattggtccggccgcctgaatgcacggccgaccgccgatgagctgatgacggcgctc
gtcgccctgatcggcgagaccgagcaggcgcagacccgcaaccacctgctcgaggagcag
ctctcggtctccgccgcccacatcgccaagctgcacaaggatctcgtcgagacgcagcgc
gcggcggcgaccgatgccctgacggggcttgccaaccgcaagacctttgacggcttcctg
cgcgactcgatcgcccggacccggagcgattccggcagcaccttctcgctgctcatgctc
gacatcgaccacttcaagggtctcaacgaccggcacggccaccgcttcggcgatcaggtg
ctgcgcctcgtcggacggctgctcagcgcgaagacgacggatcgcgacctcgccgcgcgc
tacggcggcgaggaattcgcgatcgtgctcggcgaggccggcatcggcgccggcgtcgcg
ctcgcccaggagatctgcggccggctgcggggtcagcggctggtcaagcgcggcaccggt
gatgtcgtggcacaggtcacgatctcggccggcgtcgcacagtaccgaccgggtgaagcc
gcccgcgatgtgatcgagcgggccgaccgcgcgctctacgaggccaagcggaccggccgc
gaccgcgtctgcccgacgccgcgggccgcggtcgcgtga

DBGET integrated database retrieval system