KEGG   Methylobacterium extorquens DM4: METDI3885Help
Entry
METDI3885         CDS       T00947                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase (CMK) (4-(cytidine-5'-diphospho)-2-C-methyl-D-erythritol kinase)
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00900  Terpenoid backbone biosynthesis
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    METDI3885 (ispE)
Enzymes [BR:mdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     METDI3885 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-ProteinID: CAX25522
UniProt: C7CBX5
Position
complement(3820398..3821273)
Genome map
AA seq 291 aa AA seqDB search
MSVLTTRAPAKINLTLHILGRRPGDGYHALESLVAFADVADTLELVPGPDLSLDISGPTA
GPAGPLDDNLVLRAARHLAAGVDGLRLGAFRLHKQLPVAAGIGGGSSDAAAALRLLAELN
GLALDHPAVIAAARATGADVPVCLDPRARMMRGAGEEIGPVLGLASLPAVLVNPGVPVST
APVFKALGLAVGQRLDGAEHPVVDSGLNADAVLRVIAPARNDLEAPALTVAPVIGEALAL
LRAQAGCRLARMSGSGATVFAIFSDDGAAETAAGAIRAAQPGWWVEPTRLA
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgtcctcaccacccgcgctccggccaagatcaacctgaccctgcacatcctcggc
cgccggcccggcgacggctaccatgcgctggagagcctcgtagccttcgccgacgtggcg
gacacgctggaactggtgccgggccctgatctgtcgctggacatctccggccccaccgcc
gggcccgccggaccgctcgacgacaacctcgtcctgcgcgccgcccgccacctcgctgcg
ggcgtggacggcctgaggctcggcgcgtttcgtctgcacaagcaactgcccgtggcagcc
gggatcggcggcggctcctcggatgcggctgcggccctgcggttgctcgcggaattgaac
gggctcgccctcgaccatccggccgtgatcgccgcggcgcgggccaccggcgccgacgtg
ccggtctgtctcgatccgcgggcgcggatgatgcgcggcgcgggcgaggaaatcgggccg
gtgctcggcctcgcatcgctgccggcggtgctggtcaatcccggcgtgccggtctcgacc
gcgccggtcttcaaggcgctcggcctcgcggtcggtcagcggctcgacggggcggagcat
ccggtcgtcgattctggtctcaatgcggacgccgtgctcagggtcatcgcccccgctcgc
aacgatctcgaggcgcctgctctcaccgtcgccccggtgatcggtgaagcgctggcgctg
ctacgggctcaggccgggtgccggctcgcgcggatgtcgggctccggggccaccgtgttc
gcgattttttccgatgacggggcggcggagacggcggccggagcgatccgcgctgcgcag
cccggctggtgggtcgagccgacgcggctcgcctga

DBGET integrated database retrieval system