KEGG   Methylobacterium extorquens DM4: METDI4031Help
Entry
METDI4031         CDS       T00947                                 

Definition
fatty acid oxidation complex subunit alpha (EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    METDI4031
   01212 Fatty acid metabolism
    METDI4031
  Carbohydrate metabolism
   00640 Propanoate metabolism
    METDI4031
   00650 Butanoate metabolism
    METDI4031
  Lipid metabolism
   00071 Fatty acid degradation
    METDI4031
   01040 Biosynthesis of unsaturated fatty acids
    METDI4031
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    METDI4031
   00310 Lysine degradation
    METDI4031
   00380 Tryptophan metabolism
    METDI4031
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    METDI4031
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    METDI4031
   00281 Geraniol degradation
    METDI4031
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    METDI4031
Enzymes [BR:mdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     METDI4031
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     METDI4031
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     METDI4031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3959005..3961206)
Genome map
AA seq 733 aa AA seqDB search
MTATENFRFETDADGIALATWDMPGRSMNVITMEVMAELERIVDAVVADEAIKGCVIVSG
KNNFSGGADLTMLQGLGVEYERLKASEGEEVAMRHFFEESRRLSLVFRKLETCGKPFAAA
VHGLCLGGAFELALACHHRVLADDDKTRVGLPEIKVGLFPGGGGTQRVSRLMQTGDALQM
LFKGEQIRALMAKNMGLAHAVAPAAEIVERAKAWIREGGSAVAPWDVPKFKAPSGKVYSP
AGMMIWPPANAIYRRETHDNYPAAKAILASVYEGLQLPMDLGLRVESRYFAHILRTKEAQ
AMIRTLFISMGEINKGARRPKDVEATKVGKVGVIGAGFMGAGVAYVTAQAGMQVVLIDRD
QEAADAGKAHCHKLITGQINRGKAKTADRDALLARITATPDYGTLSDCDLVIEAVFEDPK
VKAEVIAKVEAALPAHAIFASNTSTLPISGLAQTSKRPEQFVGIHFFSPVEKMLLVEIIR
GNQTGDRAVATALDYVRAIKKTGIVVNDSRGFFANRCVLAYIHEGHKMLTEGVPPAMIEN
VARMAGMPVGPLSLNDEVALDLGLKIMRATEAQLGEGAVDPDQKRLLVAMVETHGRLGRK
NKRGFYDYPEGGQKTLWPGLAEIQPNRLDPEGIDIDELKHRFLVVQALEAARTMQEGVVT
DPREADVGSILGFGFAPFTGGALSYIDFMGAKAFVALARQLEARHGARFTPPDNLLAMAE
SGARFYDALKQAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcaaccgagaatttccgcttcgagaccgatgccgacggcatcgcgctcgcgacc
tgggacatgccgggccgttcgatgaacgtcatcaccatggaggtgatggcggagctggag
cggatcgtcgacgcggtcgtcgccgacgaggccatcaagggctgcgtcatcgtctcgggg
aagaacaacttctccggcggcgccgacctcaccatgcttcagggcctcggggtcgagtac
gagcggctgaaggcgagtgagggcgaggaggtggccatgcgccacttcttcgaggaatcg
cggcgcctcagcctcgtgttccgcaagctggagacctgcggcaagccgttcgcggcggcg
gtgcacggcctgtgcctcggcggcgccttcgagctggcgctggcctgccatcaccgggtg
ctcgccgacgacgacaagacccgcgtcggcctgcccgagatcaaggtcggcctgttccca
ggcggcggcggcacgcagcgcgtgtcccgtctgatgcagaccggcgacgcgctgcagatg
ctgttcaagggcgagcagatccgcgcgctcatggccaaaaacatggggctggcccacgcc
gtcgccccggccgcggagatcgtcgagcgggccaaggcctggatccgcgagggcggctca
gcggtggcaccgtgggacgtgccgaagttcaaggcgccgtccggaaaggtctactcgccc
gccggcatgatgatctggccgccggccaacgcgatctaccgccgcgagacccacgacaat
tatccggccgccaaggcgatcctggcctcggtctacgagggcctgcaactgccgatggac
ctcggcctccgggtcgagagccgctacttcgcccatatcctgcgcaccaaggaagcgcag
gcgatgatccgcaccctgttcatctccatgggtgagatcaacaagggcgcccgccgcccg
aaggacgtggaggcgaccaaggtcggcaaggtcggcgtcatcggcgccggcttcatgggc
gcgggtgtcgcctacgtcacggcgcaggccgggatgcaggtcgtgctgatcgaccgcgat
caggaggcggccgatgccggcaaggcgcattgccacaagctcatcaccggccagatcaac
cgcggcaaggccaagaccgccgaccgcgacgcgctcctcgcccgcatcaccgccacgccc
gattacggcaccctgtccgattgcgacctcgtgatcgaggcggtgttcgaggacccgaag
gtcaaggccgaggtgatcgccaaggtcgaggcggcgctgcccgcgcacgcgatcttcgcc
tccaacacctcgaccctgccgatctccggcctcgcccagacctcgaagcgccccgagcag
ttcgtcggcatccacttcttctcgccggtggagaagatgctgctcgtggagatcatccgc
ggcaaccagaccggcgaccgcgcggtcgccaccgccctcgattacgtgcgcgcgatcaag
aagaccggcatcgtcgtcaacgattcccgcggcttcttcgccaaccgctgcgtgctcgcc
tacatccatgagggccacaagatgctcaccgagggcgtgcccccggcgatgatcgagaac
gtggcgcggatggccggcatgccggtcggcccgctctcgctcaacgacgaggtggcactc
gatctcggcctcaagatcatgcgggcgaccgaggcgcagctcggcgagggcgccgtcgat
ccggaccagaagcggctcctcgtcgcgatggtcgagacgcatggccggctcgggcgcaag
aacaagcgcggcttctacgactaccccgagggcggccagaaaacgctctggccggggctc
gccgagatccagccgaaccggctcgacccggagggcatcgacatcgacgagctgaagcac
cgcttcctcgtggtgcaggcgctggaggccgcccgcacgatgcaggagggcgtggtgacc
gatccgcgcgaggcggatgtcggctcgatcctcggcttcggcttcgccccgttcaccggc
ggcgcgctctcctacatcgacttcatgggcgcgaaggccttcgtggcgctggcccggcag
ctggaggcccggcacggcgcccgcttcaccccgccggacaacctcctggcgatggccgaa
tccggggcgcgcttctacgacgcgctgaagcaggcggcgtag

DBGET integrated database retrieval system