KEGG   Methylobacterium extorquens DM4: METDI4034Help
Entry
METDI4034         CDS       T00947                                 

Definition
(GenBank) putative 3-ketoacyl-CoA thiolase (Fatty oxidation complex beta subunit) (Beta-ketothiolase) (Acetyl-CoA acyltransferase) (fadA-like)
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    METDI4034
   00630 Glyoxylate and dicarboxylate metabolism
    METDI4034
   00640 Propanoate metabolism
    METDI4034
   00650 Butanoate metabolism
    METDI4034
  Lipid metabolism
   00071 Fatty acid degradation
    METDI4034
   00072 Synthesis and degradation of ketone bodies
    METDI4034
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    METDI4034
   00310 Lysine degradation
    METDI4034
   00380 Tryptophan metabolism
    METDI4034
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    METDI4034
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    METDI4034
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    METDI4034
Enzymes [BR:mdi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     METDI4034
Exosome [BR:mdi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   METDI4034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3962826..3964034)
Genome map
AA seq 402 aa AA seqDB search
MPEAYIYDHVRTPRGRGKPDGSLHEVTALRLAETALRALKDRNGLDTRQVDDVVLGCVDP
VGEAGGDIARAAALVADYGTHVPGVQINRFCASGLDAINFAAAQVMAGQHDLTVGGGVES
MSRVGLGASGGAWPVDPAIAVKSYFMPQGVSADLIATKYGFSRDDCDAYAVESQKRSAQS
WGEGLFRNSVVPVRDINGITLLDRDEHMRPTTDMQSLASLKPSFVQMGQMGGFDAVAVDA
HPDVEAVHHVHHAGNSSGIVDGAAAVLIGSREAGDAAGLRPRARIRAFANIGSDPALMLT
GPVDVTKKVLARAGMSLSDIDLFEINEAFASVVLRFHQAFDLDPAKVNVNGGAIAMGHPL
GATGAMILGTVLDELERTGKERALVTLCIGAGMGTATIIERV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaggcctacatctacgatcacgtccgcaccccccgcggtcgcggcaagccggac
ggttcgctgcacgaggtgacggcgttgcgcctcgccgagacggcgttgcgcgcgctcaag
gaccgcaacggcctcgacacgcggcaggtggacgacgtggtgctcggctgcgtcgatccg
gtcggcgaggccggcggcgacatcgcccgcgccgccgcgctcgtggccgattacggcacc
catgtgcccggcgtgcagattaaccgcttctgcgcctcgggcctcgatgccatcaacttc
gctgccgcgcaggtcatggccggccagcacgacctcaccgtcggcggcggcgtcgaatcg
atgagccgcgtcggcctcggcgcctcgggcggcgcctggccggtcgatccggcgatcgcg
gtcaaatcctacttcatgccgcagggcgtctcggccgacctcatcgccaccaagtacggg
ttcagccgcgacgattgcgacgcctacgccgtcgagtcgcagaagcgctcggcccaatcc
tggggcgagggcctgttccggaactccgtcgtgccggtgcgggacatcaacggcatcacc
ctgctcgaccgtgacgagcacatgcggccgacgaccgacatgcagtcgctggcgagcctg
aaaccgtccttcgtgcagatgggccagatgggcggcttcgacgccgtggccgtcgatgcc
cacccggatgtcgaggcggtccatcacgtccaccatgccggcaattcgtcgggcatcgtg
gacggcgcggcggcggtgctgattggctcgcgcgaggccggcgacgccgcgggcctgcgg
ccccgcgcccgcatccgggcgttcgccaatatcggctccgatccggcgctgatgctgacc
ggcccggtcgatgtcacgaagaaggtgctggcgcgggccggcatgagcctgtccgacatc
gacctgttcgagatcaacgaggccttcgcctcagtggtcctgcgcttccatcaggccttc
gacctcgacccagcgaaggtgaacgtcaacggcggcgccatcgccatgggccatccgctg
ggtgccacgggcgcgatgatcctcggcaccgtgctcgacgagctggagcgcaccggcaag
gagcgggcgctcgtcaccctgtgcatcggcgccggcatgggcaccgccacgatcatcgag
cgggtgtga

DBGET integrated database retrieval system