KEGG   Methylobacterium extorquens DM4: METDI4066Help
Entry
METDI4066         CDS       T00947                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00040  Pentose and glucuronate interconversions
mdi00052  Galactose metabolism
mdi00500  Starch and sucrose metabolism
mdi00520  Amino sugar and nucleotide sugar metabolism
mdi01100  Metabolic pathways
mdi01130  Biosynthesis of antibiotics
Module
mdi_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    METDI4066 (galU)
   00052 Galactose metabolism
    METDI4066 (galU)
   00500 Starch and sucrose metabolism
    METDI4066 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    METDI4066 (galU)
Enzymes [BR:mdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     METDI4066 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Smr
Motif
Other DBs
NCBI-ProteinID: CAX25700
UniProt: C7CCX0
Position
4001977..4002843
Genome map
AA seq 288 aa AA seqDB search
MKRIRKAVLPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAREAGIEHFIFVTGRG
KAVIEDHFDIAFELDHMLQERGKQAAYEELKKDLPKAGQTSFTRQQAPLGLGHAVWCARE
IVGDEPFAVLLPDMLSRGCMGQMLKAYEQHGGNVIAVEEVKPEETHQYGIVAVGETFGQT
FEITGMVEKPKQGTAPSNYIISGRYILQPEIFSILERGETGAGGEIQLTDAMIRLAEEQK
FFGLRFDGRTYDTGSKIGFLTANLAYGLERPELADALKAEIRALLGEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattcgcaaggccgtccttcccgtcgcgggtctcggcacgcgcttcctgccg
gccaccaaggccgttccgaaggagatgctcaccgtcgtcgaccgcccggtcgtccagcac
gtcgtcgatgaagcccgcgaggccggcatcgagcacttcatcttcgtgaccggccgcggc
aaggcggtgatcgaggatcatttcgatatcgcgttcgaattggaccacatgctgcaggag
cgcggcaagcaggcggcctacgaggagttgaagaaggacctgcccaaggccggccagacc
agcttcacccggcagcaggcaccgctgggcctcggccacgccgtctggtgcgcccgcgag
attgtcggcgacgaacccttcgccgtgctgctgccggacatgctgagccgcggctgcatg
ggccagatgctgaaagcctacgagcagcatggcggcaacgtcatcgccgtggaagaggtg
aagcccgaggagacccaccagtacggcattgtcgccgtcggcgagaccttcggccagacc
ttcgagatcaccggcatggtcgagaagcccaaacagggcaccgcgccctcgaactacatc
atctccggccgctacatcctccagcccgagatcttctcgattctggagcggggcgagacc
ggcgcgggcggcgagatccagctcaccgacgcgatgatccggctggccgaagagcagaaa
ttctttgggctgcgcttcgatgggcgcacctacgacaccgggtccaagatcggcttcctc
accgccaacctcgcctacggcctggagcggccggaactggccgatgccctgaaagcggag
atccgcgcgcttctcggcgaggcttaa

DBGET integrated database retrieval system