KEGG   Methylobacterium extorquens DM4: METDI4066Help
Entry
METDI4066         CDS       T00947                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    METDI4066 (galU)
   00052 Galactose metabolism
    METDI4066 (galU)
   00500 Starch and sucrose metabolism
    METDI4066 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    METDI4066 (galU)
Enzymes [BR:mdi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     METDI4066 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4001977..4002843
Genome map
AA seq 288 aa AA seqDB search
MKRIRKAVLPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAREAGIEHFIFVTGRG
KAVIEDHFDIAFELDHMLQERGKQAAYEELKKDLPKAGQTSFTRQQAPLGLGHAVWCARE
IVGDEPFAVLLPDMLSRGCMGQMLKAYEQHGGNVIAVEEVKPEETHQYGIVAVGETFGQT
FEITGMVEKPKQGTAPSNYIISGRYILQPEIFSILERGETGAGGEIQLTDAMIRLAEEQK
FFGLRFDGRTYDTGSKIGFLTANLAYGLERPELADALKAEIRALLGEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgaattcgcaaggccgtccttcccgtcgcgggtctcggcacgcgcttcctgccg
gccaccaaggccgttccgaaggagatgctcaccgtcgtcgaccgcccggtcgtccagcac
gtcgtcgatgaagcccgcgaggccggcatcgagcacttcatcttcgtgaccggccgcggc
aaggcggtgatcgaggatcatttcgatatcgcgttcgaattggaccacatgctgcaggag
cgcggcaagcaggcggcctacgaggagttgaagaaggacctgcccaaggccggccagacc
agcttcacccggcagcaggcaccgctgggcctcggccacgccgtctggtgcgcccgcgag
attgtcggcgacgaacccttcgccgtgctgctgccggacatgctgagccgcggctgcatg
ggccagatgctgaaagcctacgagcagcatggcggcaacgtcatcgccgtggaagaggtg
aagcccgaggagacccaccagtacggcattgtcgccgtcggcgagaccttcggccagacc
ttcgagatcaccggcatggtcgagaagcccaaacagggcaccgcgccctcgaactacatc
atctccggccgctacatcctccagcccgagatcttctcgattctggagcggggcgagacc
ggcgcgggcggcgagatccagctcaccgacgcgatgatccggctggccgaagagcagaaa
ttctttgggctgcgcttcgatgggcgcacctacgacaccgggtccaagatcggcttcctc
accgccaacctcgcctacggcctggagcggccggaactggccgatgccctgaaagcggag
atccgcgcgcttctcggcgaggcttaa

DBGET integrated database retrieval system