KEGG   Methylobacterium extorquens DM4: METDI4201Help
Entry
METDI4201         CDS       T00947                                 

Definition
(RefSeq) beta N-acetyl-glucosaminidase (EC:3.2.1.52)
  KO
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Amino sugar and nucleotide sugar metabolism
beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    METDI4201
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    METDI4201
Enzymes [BR:mdi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     METDI4201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4134850..4135881
Genome map
AA seq 343 aa AA seqDB search
MTSASMTSASTPRAVILGCSGTALTPEEAAFFRDLRPWGFILFKRNIGTPDEVRALTAAL
RETVGRADAPILIDQEGGRVQRMGPPHWPKYPAGGRFGALGDDAAAMARLGARLMAHDLA
SVGINVDCAPMLDVPVAGSDNIIGDRAYGDTPERVIELGRAVAEGLMAGGVLPVIKHIPG
HGRATCDSHLDLPVVEADRVSLGESDFRPFRALADLPLAMSAHVVFTALDPEQPATLSER
VIREIVRGEIGFDGLLMTDDLSMHALQGPFRERAQAAYRAGIDVVLHCNGRMDEMRAVAE
AASDLAGEGARRAEAALARLTPPDAIDVDEARARFDAAFGAVA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagccagcatgacctccgccagcacgccccgcgccgtcatcctcggctgttcc
ggtacggcgctgacgcccgaggaggccgccttcttccgcgatctgcggccctggggcttc
attctgttcaagcgcaacatcggcacgccggacgaggtgcgcgccctgaccgccgccctg
cgcgagacggtcgggcgggcggatgcgccgatcctgatcgatcaggagggcgggcgggtg
cagcgcatgggcccgccgcactggccgaaatatcccgcgggcggccgcttcggcgccctc
ggtgacgacgccgcggcgatggcccggctcggcgcccggctgatggcgcacgacctcgcc
tcggtcggcatcaacgtcgattgcgcgccgatgctcgacgtccccgtcgcgggctcggac
aacatcatcggcgaccgggcctacggcgacacgccggagcgggtgatcgaactcggccgc
gccgtcgccgaagggctgatggcgggcggcgtgctgccggtcatcaagcacattcccggt
cacggccgggcgacctgcgacagccatctcgacctgcccgtggtcgaggccgaccgcgtg
agtctgggcgagagcgacttccgcccgttccgggcgctggccgacctgccgctcgccatg
agcgcgcatgtggtgttcaccgccctcgaccctgagcagcccgccaccctgtcggagcgc
gtgatccgcgagatcgtgcggggcgagatcggcttcgacggcctcctgatgaccgacgac
ctgtcgatgcacgcgctccagggcccgttccgcgaacgggcgcaagccgcctaccgcgcc
ggcatcgatgtggttctccattgcaacggacgcatggacgagatgcgcgccgtcgccgaa
gccgcgtccgatctggcgggggagggcgcacgccgggccgaggccgcgcttgcccgcctc
acgcctccggatgccatcgacgtggatgaggcgcgcgcgcgcttcgacgcggccttcggc
gctgtcgcataa

DBGET integrated database retrieval system