KEGG   Methylobacterium extorquens DM4: METDI4201Help
Entry
METDI4201         CDS       T00947                                 

Definition
beta N-acetyl-glucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mdi00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:mdi00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4134850..4135881
Genome map
AA seq 343 aa AA seqDB search
MTSASMTSASTPRAVILGCSGTALTPEEAAFFRDLRPWGFILFKRNIGTPDEVRALTAAL
RETVGRADAPILIDQEGGRVQRMGPPHWPKYPAGGRFGALGDDAAAMARLGARLMAHDLA
SVGINVDCAPMLDVPVAGSDNIIGDRAYGDTPERVIELGRAVAEGLMAGGVLPVIKHIPG
HGRATCDSHLDLPVVEADRVSLGESDFRPFRALADLPLAMSAHVVFTALDPEQPATLSER
VIREIVRGEIGFDGLLMTDDLSMHALQGPFRERAQAAYRAGIDVVLHCNGRMDEMRAVAE
AASDLAGEGARRAEAALARLTPPDAIDVDEARARFDAAFGAVA
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagccagcatgacctccgccagcacgccccgcgccgtcatcctcggctgttcc
ggtacggcgctgacgcccgaggaggccgccttcttccgcgatctgcggccctggggcttc
attctgttcaagcgcaacatcggcacgccggacgaggtgcgcgccctgaccgccgccctg
cgcgagacggtcgggcgggcggatgcgccgatcctgatcgatcaggagggcgggcgggtg
cagcgcatgggcccgccgcactggccgaaatatcccgcgggcggccgcttcggcgccctc
ggtgacgacgccgcggcgatggcccggctcggcgcccggctgatggcgcacgacctcgcc
tcggtcggcatcaacgtcgattgcgcgccgatgctcgacgtccccgtcgcgggctcggac
aacatcatcggcgaccgggcctacggcgacacgccggagcgggtgatcgaactcggccgc
gccgtcgccgaagggctgatggcgggcggcgtgctgccggtcatcaagcacattcccggt
cacggccgggcgacctgcgacagccatctcgacctgcccgtggtcgaggccgaccgcgtg
agtctgggcgagagcgacttccgcccgttccgggcgctggccgacctgccgctcgccatg
agcgcgcatgtggtgttcaccgccctcgaccctgagcagcccgccaccctgtcggagcgc
gtgatccgcgagatcgtgcggggcgagatcggcttcgacggcctcctgatgaccgacgac
ctgtcgatgcacgcgctccagggcccgttccgcgaacgggcgcaagccgcctaccgcgcc
ggcatcgatgtggttctccattgcaacggacgcatggacgagatgcgcgccgtcgccgaa
gccgcgtccgatctggcgggggagggcgcacgccgggccgaggccgcgcttgcccgcctc
acgcctccggatgccatcgacgtggatgaggcgcgcgcgcgcttcgacgcggccttcggc
gctgtcgcataa

DBGET integrated database retrieval system