KEGG   Methylobacterium extorquens DM4: METDI4540Help
Entry
METDI4540         CDS       T00947                                 

Definition
(GenBank) putative Zn-containing alcohol dehydrogenase (adh)
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00010  Glycolysis / Gluconeogenesis
mdi00071  Fatty acid degradation
mdi00350  Tyrosine metabolism
mdi00625  Chloroalkane and chloroalkene degradation
mdi00626  Naphthalene degradation
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
mdi01130  Biosynthesis of antibiotics
mdi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI4540
  Lipid metabolism
   00071 Fatty acid degradation
    METDI4540
  Amino acid metabolism
   00350 Tyrosine metabolism
    METDI4540
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    METDI4540
   00626 Naphthalene degradation
    METDI4540
Enzymes [BR:mdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     METDI4540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: CAX26164
UniProt: C7CFN0
Position
complement(4429667..4430650)
Genome map
AA seq 327 aa AA seqDB search
MLAMVLREVGAPLVPEERPDPVPGPGEVRIRVEACAVCRTDLHLIDGELPQAVYPIVPGH
EVVGCVEALGLGVTEPRPGTRVGVPWLGHACGHCRYCGSGRENLCDAPGFTGCTRDGGFA
SHLVAEAAFTIPLDPALDAVATAPLLCAGLIGWRTLRMAGEAGTVGLYGFGAAAHIIAQV
CRWQGRRVFAFTRPGDREAQAFARTLGAEWAGDSDGQPPEPLDAALIFAPDGSLVPAALA
AVRKGGRVVCGGIHMSDIPAFPYDLLWGERAVLSVANLTREDARTFFEILPQAGIVTRTR
AFPLTQANAAIAAHRCGALQGAAVLVP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctggcgatggtcctgcgcgaggtcggcgctcccctcgtcccggaggagcgtccggac
ccggttcctgggccgggcgaggtccgcatccgggttgaggcctgcgccgtctgccgtacc
gacctccacctcatagacggcgagcttccgcaggcggtctaccccatcgtgccgggccac
gaagtcgtcgggtgcgtcgaggccctcggtttaggcgtgaccgagcctcgaccgggtacc
cgcgtgggcgtgccctggctcgggcatgcctgcgggcattgccgctactgcgggagcggc
cgcgagaacctctgcgacgcgcccggcttcaccggctgcacgcgcgatggcggcttcgcg
agccacctcgtggccgaggccgccttcaccatcccgctcgacccggccctcgacgcggtc
gcgacggcgccgctcctttgcgctggtctgatcggctggcgcacgttgcgaatggccggg
gaggctgggaccgttggactctatggcttcggggcggctgcccacatcatcgcgcaggtc
tgccgctggcaggggcggcgcgtgttcgccttcactcggccaggcgaccgggaggcgcag
gccttcgcccgcacgctgggagcggagtgggctggggactccgacggccagccgcccgaa
ccgttggacgccgcgctcatcttcgccccagacgggagcctcgtgcccgccgctcttgca
gcggttcgcaagggcggccgcgtggtctgcggcggcatccacatgagcgacatcccggcc
ttcccctacgacctgctctggggcgagcgcgcggtgttatcggtggcgaacctgacccgc
gaggacgcgcggaccttcttcgagatcctgccgcaggccggcatcgtcacccgtacacgc
gccttccccctcactcaggccaacgcggccatcgcagcccaccgctgcggggctcttcaa
ggtgcagccgtcctcgtcccctga

DBGET integrated database retrieval system