KEGG   Methylobacterium extorquens DM4: METDI4592Help
Entry
METDI4592         CDS       T00947                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, membrane anchor subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00020  Citrate cycle (TCA cycle)
mdi00190  Oxidative phosphorylation
mdi00650  Butanoate metabolism
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
mdi01130  Biosynthesis of antibiotics
mdi01200  Carbon metabolism
Module
mdi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mdi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mdi_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    METDI4592 (sdhD)
   00650 Butanoate metabolism
    METDI4592 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    METDI4592 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: CAX26215
UniProt: C7CGA3
Position
4471129..4471548
Genome map
AA seq 139 aa AA seqDB search
MSQVDNRQNTALSMRTPRARVKGLGASGHGAGHFWLQRLTGASNALLMLAFVVIIALMAG
RTYPQAVALVSHPLVAIILILAVVSVTIHMRLGMQTVIEDYVHSHGLKFAALIANTFYAV
AVAAACLYAILRVSLGGLA
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaggtcgacaaccgccagaacaccgcgctctccatgcgcacgccccgcgcccgg
gtgaagggcctcggcgcttcgggccacggcgccggccatttctggctgcagcgcctgacc
ggcgcctcgaacgcgctcctgatgctcgccttcgtcgtgatcatcgcgctgatggccggg
cggacctacccgcaggcggtcgcgctggtgtcgcacccgctggttgcgatcatcctgatc
ctggccgtggtgtcggtgacgatccacatgcgtctcggcatgcagacggtcatcgaagac
tacgtccacagccacggcctcaagttcgcggcgctcatcgccaacaccttctacgcggtc
gcggtggccgctgcctgcctctacgcgatcctccgcgtgagcctgggcggcctcgcctga

DBGET integrated database retrieval system