KEGG   Methylobacterium extorquens DM4: METDI4914Help
Entry
METDI4914         CDS       T00947                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    METDI4914
Enzymes [BR:mdi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     METDI4914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4810300..4811337)
Genome map
AA seq 345 aa AA seqDB search
MADESESAGARAERLARFQPASGMLTPRFSGLASFMRLPVLDPVEAVGDGAGEGAGEGTG
LVEIGLIGIPFDGTTTNRPGARLGPRAVREASTGTRALNHATGVAPYALAACADLGDVPV
NPVDAAETARRIEAFYRPLAEAGIVPLTVGGDHFVTYPVLRALGAARPLGLIHIDAHSDT
DDTQYGGARLTHGTPFRRAVEDGVLDPRRCIQIGIRGSMDAADERDWALAQGMRILTMEE
VCARGLPEVAAEARAVTGDGPTYLSFDIDALDPAFAPGTGTPEIGGFTTREALHLLRALR
GLDLVGADVVEVAPPLDSAGITALAGAGIAFEILCLLAERVAARH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggcggatgagagcgaatcggcgggcgcgcgggcggaacggctggcgcggttccagccg
gcctcggggatgctgacaccacgcttctcggggctggcgagcttcatgcggctgccggtg
ctcgatcccgtcgaggcggtgggcgacggggccggcgaaggggctggcgaagggactgga
ctggtcgagatcggcctgatcggcatccccttcgacggcaccaccaccaaccgccccggt
gcccggctcgggccgcgggcggtgcgcgaggcctccaccggcacgcgggcgctcaaccac
gccacgggggtggcgccctacgccctggcggcctgcgccgatctcggcgacgtgccagtc
aacccggtggacgccgccgagaccgcccggcggatcgaggcgttctaccggccgctcgcc
gaggccgggatcgtgccgctcacggtcggcggcgaccatttcgtcacctatccggtgctg
cgggcgctcggggccgcccggccgctcgggctgatccatatcgacgcccacagcgacacc
gatgacacccagtatggcggggcgcggctcacccacggcacgccgttccgccgcgcggtc
gaggacggggtgctcgacccgcggcgctgcatccagatcggcatccgcggcagcatggat
gcggccgacgagcgcgactgggccctggcgcagggcatgcgcatcctcacgatggaagag
gtctgcgcccgcggcctgccggaggtggccgcggaagcccgggccgtgaccggcgacggc
ccgacctatctcagcttcgacatcgacgccctcgatcccgccttcgcccccggcaccggc
acgccggagatcggcggcttcaccacccgcgaggcgctgcacctgctgcgggccctgcgc
ggcctcgatctcgtcggagcggatgtggtggaggtcgctcctccgctcgattccgccggc
atcacggcgctggcgggcgccggcatcgccttcgagatcctgtgcctgctggccgagcgg
gtcgccgcacgacactga

DBGET integrated database retrieval system