KEGG   Methylobacterium extorquens DM4: METDI4976Help
Entry
METDI4976         CDS       T00947                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mdi  Methylobacterium extorquens DM4
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4876164..4877231)
Genome map
AA seq 355 aa AA seqDB search
MSPDPDRDRSFVLAQRSFELMRDYCACATPRAYAVWYLYVSGTQPLMNDAVKRLTTQNGT
LTSADIEGLHDTYIDGRRMAVEVDRMNSSLIAEVEGIMEMIEVSIRSTAQYGESLQALSH
DIANTATSRTRLREVVTTIIANTRDVTANNRTLEARMRESRSEIEALRETLEATRLESLT
DALTGLGNRKSFEESLRKSVDRQSASAQLGKPASLIVIDIDSFKRFNDLYGHLTGDQVLR
LVAIVMREHIGQKNATLARFGGEEFGIVLPETDRVEARAIAERVRIGVTGRELVKRSTGE
SLGKVTVSLGVATQREDDNAVSLLERADACLFAAKRAGRNRTLDETEVENLRDVA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagccccgatcccgatcgtgatcgcagtttcgtgctcgcgcagcgcagcttcgagctg
atgcgcgactactgtgcctgcgcgacgccgcgggcctacgccgtgtggtatctctacgtc
tccggcacgcagccgctgatgaacgatgcggtcaagcggctcacgacgcagaacggcacg
ctgaccagcgctgacatcgaggggctccacgacacctacatcgacggccgccgcatggcc
gtggaggtggaccggatgaattcgagcctcatcgccgaggtcgagggcatcatggagatg
atcgaggtctcgatccgctccaccgcccagtacggcgagtcgcttcaggccctgtcccac
gacatcgccaacacggccacgagccggacgcgtctgcgcgaggtcgtcacgacgatcatc
gccaacacccgcgacgtgaccgccaacaaccgcaccctcgaagcgcggatgcgcgagagt
cgcagcgagatcgaggccttgcgcgagacgctggaagcgacccgtctggagagcctgacc
gacgccctgacggggctgggcaaccgcaagagtttcgaggagtcgctccgcaagagcgtc
gatcggcagtctgcctcggcgcagctgggcaagccggcgagcctgatcgtgatcgacatc
gattcgttcaagcgcttcaatgacctctacggccacctgaccggggatcaggtgctgcgc
ctcgtcgccatcgtgatgcgcgagcatatcggtcagaaaaacgcgacgctcgcccggttc
ggcggcgaggaattcggcatcgtcctgccggaaacggaccgggtcgaggcgcgcgccatt
gccgagcgggtgcgcatcggcgtcaccggccgcgagctggtgaagcgctccaccggcgaa
tcgctcggcaaggtcacggtctcgctcggcgtcgccacccagcgcgaggatgacaacgcg
gtctccctgctggaacgggccgatgcctgcctgttcgccgccaagcgcgccggccgcaac
cgcaccctcgacgagaccgaagtcgagaacctgcgcgacgtcgcctga

DBGET integrated database retrieval system