KEGG   Methylobacterium extorquens DM4: METDI4988Help
Entry
METDI4988         CDS       T00947                                 

Definition
acyl-CoA thioesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mdi01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4885167..4885949
Genome map
AA seq 260 aa AA seqDB search
MHHANEAEAGPGRHASRYVSRLGARREAAAPDVGPRRLRRRAALMLLFAAATLVGAAGLL
PGSARAEPSPLKLVAFGDSLTAGYRLPADAAFPAVLERALKAKGYRVEIANAGVSGDTST
GGLDRLDWSVPDGTQAVILELGANDMLRGTDPAVTRKALETIIARLKERNIPVLLAGMLA
APNLGTEYRARFDAIYPDLAKAHGLVLYPFFLDGVTGQRANTMDDGLHPTAKGVERIVEG
ILPSVETFLGRLGQNPEKKG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
ttgcaccatgcgaacgaagcggaagccggacccggcaggcatgcgtcacgctatgtgtca
cgcttgggcgcccggcgcgaggcggccgcacccgatgtggggccgcgccgcctccggcgc
agggccgcgctgatgctcctcttcgccgcagccacgctcgtcggcgccgcgggcttgctg
cccggctcggcccgtgccgagccgtcgccgctcaagctcgtggctttcggcgacagcctc
accgccggctaccgcctgccggccgacgccgcctttcccgcggtgctggagcgggcgctg
aaggccaaggggtaccgggtcgagatcgccaatgccggcgtgtcgggcgacaccagcacc
ggcgggctcgaccggctcgactggtcggtgccggacggcacgcaagcggtgatcctcgaa
ctcggcgccaacgacatgctgcgcggcaccgatccggcggtgacgcgcaaggcgctcgag
acgatcatcgcgcggctgaaggagcgcaacatcccggtgctgctcgccggcatgctggcc
gcgccgaatctcggcacggagtaccgcgcccggttcgacgcgatctatcccgacttggcc
aaggcgcacggcctcgtgctctacccgttctttctcgacggcgtgacgggccaacgcgcc
aacacaatggatgacgggctgcaccccaccgccaagggcgtcgagcggatcgtcgagggc
atcctgccgagcgtcgagaccttcctgggccgcctgggccagaatccggagaagaagggg
tag

DBGET integrated database retrieval system