KEGG   Methylobacterium extorquens DM4: METDI5119Help
Entry
METDI5119         CDS       T00947                                 

Definition
phosphomannomutase/phosphoglucomutase (EC:5.4.2.8 5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI5119
   00030 Pentose phosphate pathway
    METDI5119
   00051 Fructose and mannose metabolism
    METDI5119
   00052 Galactose metabolism
    METDI5119
   00500 Starch and sucrose metabolism
    METDI5119
   00520 Amino sugar and nucleotide sugar metabolism
    METDI5119
  Nucleotide metabolism
   00230 Purine metabolism
    METDI5119
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    METDI5119
Enzymes [BR:mdi01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     METDI5119
    5.4.2.8  phosphomannomutase
     METDI5119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5038781..5040304
Genome map
AA seq 507 aa AA seqDB search
MSFDTSKAFPTPVPKLEPNTFAFEQLPMVKPTGFREYDARWLFPQEINLMGVQALGLGLG
TLIHERGVRPDIVTGHDFRAYSASIKLALIAGMQAAGLRVKDIGLALSPMAYFGQFALDC
PCVAMVTASHNDNGWTGVKMGAERPMTFGPDEMGRLKEIVTTGAFQYRDGGAYEFVSDFA
QVYLDDLVARAKPVSRKLKVVAACGNGTAGAFAPALLERLGVEVIPLDVEPDHSFPRYNP
NPEDMAMLHAIADKVRETGADVGLGFDGDGDRCGVVDDEGEEIFADKIGVMLARDLSKLH
PNATFVVDVKSTGLYAADPELQARGVRTDYWKTGHSYIKRRVNELSALAGFEKSGHFFFN
APVGRGYDDGLLTAIAVIEMLDRNPGQTMADLYRALPKTWGSPTMSPHCADEVKYGVVEA
VTERFRALEASGEPVGGHPITSLVTVNGVRVTTADGTWGLVRASSNKPELVVVVESPVSE
ARLREMFAAVDGVLRQHPEVGAYNQTI
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcgatacctccaaggcctttcccacgcccgttccgaagcttgagcccaacacc
ttcgccttcgagcagctgccgatggtcaagcccactggctttcgcgagtacgacgcccgc
tggctgttcccgcaggagatcaacctgatgggcgtccaggcgctcggcctcggcctcggc
acgctgatccatgagcgcggcgtgcgccccgacatcgtcaccggccatgactttcgcgcc
tactccgcctcgatcaagctcgcgctgatcgccgggatgcaggcggcggggctgcgggtg
aaggatatcgggctcgcgctctcgccgatggcctatttcggccagttcgccctcgattgc
ccctgcgtggccatggtcaccgcctcgcataacgacaacggctggaccggcgtgaagatg
ggcgccgagcgccccatgactttcggccccgacgagatgggccgcctcaaggagatcgtc
accacgggcgcgttccagtaccgcgacggcggcgcctacgaattcgtctccgacttcgct
caggtctatctcgacgacctcgtcgcgcgcgccaaacccgtctcgcgaaagctgaaggtc
gtggccgcctgcggcaacggcaccgccggcgccttcgcacccgcgctgctggagcggctc
ggcgtcgaggtgatcccgctcgatgtcgagccggatcacagcttcccgcgctacaacccc
aaccccgaggacatggcgatgctgcacgccatcgccgacaaggtgcgcgagaccggcgcc
gatgtcggcctcggcttcgacggcgacggcgaccgctgcggcgtggtcgatgacgagggc
gaggagatcttcgccgacaagatcggcgtcatgctggcccgcgacctgtcgaagcttcac
ccgaacgcgaccttcgtggtcgacgtgaaatcgaccggcctctacgccgccgatcccgag
ttgcaggcccgcggcgtgcgcaccgattactggaagacggggcattcctacatcaagcgc
cgcgtcaacgaactctcggcgctcgccggcttcgagaagtcgggccacttcttcttcaat
gccccggtcggccgcggctacgacgacggcttgctcacggcgatcgcggtgatcgagatg
ctcgaccgcaatccggggcagaccatggccgacctctaccgggcgctgccgaagacctgg
ggctcgccgaccatgtcgccgcattgcgccgacgaggtgaagtacggcgtggtcgaagcg
gtgaccgagcggttccgggcgctcgaggcgtcgggcgagccggtgggcggccatcccatc
accagtctcgtgacggtcaatggcgtgcgcgtgaccaccgccgacggcacctgggggctg
gtgcgggcctcctcgaacaagccggaactcgtggtggtggtggagagcccggtctccgaa
gcgcggcttcgcgagatgttcgcggcggtggatggggtgctgcgccagcacccggaagtg
ggcgcctacaaccagacgatttga

DBGET integrated database retrieval system