KEGG   Methylobacterium extorquens DM4: METDI5235Help
Entry
METDI5235         CDS       T00947                                 

Gene name
pcm
Definition
L-isoaspartate protein carboxylmethyltransferase type II (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mdi  Methylobacterium extorquens DM4
Brite
Enzymes [BR:mdi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     METDI5235 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5162370..5163068)
Genome map
AA seq 232 aa AA seqDB search
MPPEAGEPDERADRLSAGLAEATGNAAFVLALRERGVRDTAVLRAMEQVPRERFAPPALR
PHARRDIALPLACGQTMTAPSVVAQMLGALDLAPGQRVLEVGTGTGYVTALLVRLGAAHV
RSLERYEGLARAARAHLGRDLSDVTVETNDGLAPEVVRGGSYDRILVNGSLAALPPHLPA
ALKSGGRLVVGHWTGRGSRLVTLTRDSAAAYARTEGAALRLGPLTPGRALAP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctgaggccggagagcccgacgaacgggctgatcggctgtccgcggggctggcg
gaggcgaccggcaacgccgccttcgtgctggccctgcgcgagcggggcgtgcgcgacacc
gccgtgctgcgggcgatggaacaggtgccgcgcgagcgcttcgcgccgccggccctgcgc
ccgcatgcgcggcgcgacatcgccctgccgctcgcctgcggccagaccatgaccgcgccg
agcgtggtcgcgcagatgctcggcgccctcgacctcgcccccggccagcgcgtgctggag
gtcggcaccggcacgggctacgtcaccgccctgctggtccggctcggggccgcccatgtg
cgcagcctggagcgctacgaggggctcgcccgcgcggcgcgagcgcatctggggcgcgac
ctttccgacgtcaccgtcgagaccaatgacgggctcgcccccgaagtcgtgcggggcgga
agctacgaccgcatcctcgtcaacggcagcctggccgcgctgccgccgcacctccccgcc
gcgctcaaatccggcggccggctggtggtgggccattggaccgggcgggggagccggctc
gtgacgctgacccgcgacagcgcggccgcctacgcccggacggaaggggcggccctgcgc
ctcggccctctgacgccgggacgcgcgctggcgccgtag

DBGET integrated database retrieval system