KEGG   Methylobacterium extorquens DM4: METDI5241Help
Entry
METDI5241         CDS       T00947                                 

Definition
(GenBank) putative enoyl-CoA hydratase/isomerase family protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00071  Fatty acid degradation
mdi00280  Valine, leucine and isoleucine degradation
mdi00281  Geraniol degradation
mdi00310  Lysine degradation
mdi00360  Phenylalanine metabolism
mdi00362  Benzoate degradation
mdi00380  Tryptophan metabolism
mdi00410  beta-Alanine metabolism
mdi00627  Aminobenzoate degradation
mdi00640  Propanoate metabolism
mdi00650  Butanoate metabolism
mdi00903  Limonene and pinene degradation
mdi00930  Caprolactam degradation
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01120  Microbial metabolism in diverse environments
mdi01130  Biosynthesis of antibiotics
mdi01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    METDI5241
   00650 Butanoate metabolism
    METDI5241
  Lipid metabolism
   00071 Fatty acid degradation
    METDI5241
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    METDI5241
   00310 Lysine degradation
    METDI5241
   00360 Phenylalanine metabolism
    METDI5241
   00380 Tryptophan metabolism
    METDI5241
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    METDI5241
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    METDI5241
   00281 Geraniol degradation
    METDI5241
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    METDI5241
   00627 Aminobenzoate degradation
    METDI5241
   00930 Caprolactam degradation
    METDI5241
Enzymes [BR:mdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     METDI5241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_2 ECH_1
Motif
Other DBs
NCBI-ProteinID: CAX26854
UniProt: C7CLK5
Position
complement(5167167..5168327)
Genome map
AA seq 386 aa AA seqDB search
MSGGQQALQQGVAQRDVREPSAEPEIVFETRGEAGLITLTRPKALNALTLPMVEAMHRQL
RAWAGDARVSRVVVRGSGGRAFCAGGDIRQIQALGKAGRHADVMAFWRGEYWLDAAVKSY
PKPYIALIEGIVMGGGVGISLHGDVRVAAENYSFAMPETGIGFFPDVGATYALPRLPGCT
GRYLALTGARIGAGDALAVGLATHTARAEDFETIIERLAGGGAIARAFDGLDAPGTETGP
LVTERTLIDACFSADTVTEVLARLDAAARDGSAFAGATAATIRTRSPTSLTIALAQMRRG
ADLSFAEAMLAEYRLCERVMRGHDFYEGVRAVIIDKDNRPAWQPATLDAVDAGAIEAAFG
PLDGPEPLFDGSQGPPEASPIAEARS
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtgggcaacaggccttgcagcaaggggtcgcgcaacgggacgtgcgtgagccg
tcggccgagcccgagatcgtgttcgagacccgcggcgaggccgggctgatcaccctgaca
cggccgaaggcgctcaacgccctcaccctgccgatggtggaggcgatgcaccggcagctc
cgggcctgggcgggggatgcgcgggtcagccgggtcgtggtgcgcggctcgggcgggcgc
gccttctgcgcgggcggcgacatccgccagatccaggccctcggcaaggccgggcgccat
gccgacgtgatggcgttctggcgcggggaatactggctcgacgccgccgtgaagtcctac
ccgaagccctacatcgccctgatcgaagggatcgtgatgggcggcggtgtcggcatctcg
ctgcacggcgacgtgcgggtcgcggccgagaactacagcttcgccatgcccgagaccggc
atcggcttcttccccgatgtcggcgcgacctacgccctgccgcgcctgcccggctgcacc
gggcgctacctcgcgctgacgggcgcacggatcggtgcgggcgacgcgctcgccgtcggc
ctcgcgacccacacggcgcgggcggaggatttcgagaccatcatcgagcggctggcgggg
ggaggggcgatcgcccgcgccttcgacggcctcgatgcgccggggacggagaccgggccc
ctcgtcaccgagcggacgctgatcgacgcgtgcttctccgccgacaccgtcacggaggtg
ctcgcccggctcgacgcggcggcgcgggacggctccgcttttgccggcgcgaccgcggcg
acgatccgcacccgctcgcccaccagcctgaccatcgccctggcgcagatgcgccgcggg
gccgacttgagctttgccgaagcgatgctcgccgagtaccggctgtgcgagcgggtgatg
cgcgggcacgatttctatgaaggtgtgcgggcggtgatcatcgacaaggacaaccggccg
gcctggcagcccgcgaccctggacgcggtcgatgccggggcgatcgaggccgcgttcggc
ccgctcgacggccccgagccgctcttcgacggcagtcagggcccgcccgaagcgtcgccc
atcgcggaggcccggtcgtga

DBGET integrated database retrieval system