KEGG   Methylobacterium extorquens DM4: METDI5469Help
Entry
METDI5469         CDS       T00947                                 

Definition
acetyl-coenzyme A synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    METDI5469
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI5469
   00620 Pyruvate metabolism
    METDI5469
   00640 Propanoate metabolism
    METDI5469
  Energy metabolism
   00680 Methane metabolism
    METDI5469
Enzymes [BR:mdi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     METDI5469
Lipid biosynthesis proteins [BR:mdi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   METDI5469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5416187..5417875)
Genome map
AA seq 562 aa AA seqDB search
MQRAREEEAAPAERRRKFEEVAVPERADRYETLVRDFRWEIPERYNIAADVCDRWALSEP
DRTALLVLGPDDRPEPVSYGRLRSDSLRLAAALAARGVGPGDRVAVLLPQSAAVVVTHFA
AYRLGAIALPLAGLFGEAALHHRLADSGACAVVTDAPGLAKLERLRADLPDLVTILSVDG
AGEAAEDFFAALENAPDGFATRATGPDDPALMIYTSGTTGLAKGALHGHRVLLGHLPGWS
VMHGFPPEGTGLMWTPSDWAWAGGLLNVLMPSLRLGMPVVAKASGRFEPEAAFRLMADLG
VTHAFLPPTALRMLRGVADPRQTFDLSALRNIASAGEALGAETFDWARNALGLTIGEAYG
QTECNLVLASSARIGVARAGATGKPVPGHRVAVLREDGTEADADESGEIAVRAPDPVLFL
GYWRQPEATAKKFRDGWWMTGDQARRDADGYIRFVGREDDLITSAAYRIGPAEIEACLCA
HPAVALAAAVGVPDPLRTETVKAFVTLRAGFSPSDALAAEILAFAKARLSAHEVPRALAF
RDTLPMTTSGKIIRRQLRDEPA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcgcccgggaggaagaggcggcaccggccgagcgccgccgcaagttcgaggaa
gttgccgtgccggagcgggccgatcgctacgagacgctcgtcagggatttccgctgggag
atcccggagcgctacaacatcgcggccgatgtctgcgaccgctgggcgctgagcgagccc
gaccgcaccgcgctcctcgtgctcggccccgacgaccggcccgagccggtgagctacggc
cgcctgcgctccgattcgctgcggctcgcggcggccctggccgcgcgcggcgtcgggccg
ggcgaccgggtggcggtgctgctgccgcaatcggcggcggtggtggtgacccatttcgcc
gcctaccggctcggggcgatcgcactcccgcttgccggcctgttcggtgaggcggccctg
caccatcgcctcgccgattccggcgcctgcgccgtcgtcaccgacgcgcccgggctggcg
aagctggagcggctgcgcgccgacctgccggatctcgtcacgatcctctcggtcgatggg
gcaggagaggccgcggaggatttcttcgcggctctggagaacgccccggacgggttcgcg
acgcgggcgacggggccggacgatccggccctgatgatctacacctccggcaccaccggc
ctcgccaagggggcgctgcacggccaccgggtcctgctcggccacctgccgggctggagc
gtaatgcacggcttcccgcccgagggaaccgggctgatgtggacgccctccgactgggcc
tgggccgggggcctgctcaacgtgctgatgccgtccttgcgcctcggcatgccggtggtc
gcgaaggcctcgggccggttcgagccggaggcggcgttccggctgatggcggatctcggc
gtcacccacgctttcctgccgccgacggctttgcgcatgctgcgcggagtggccgatccg
cgccaaacattcgacctctcagccctgcgcaacatcgcctctgccggcgaggcgctcggg
gccgagaccttcgattgggcgcgtaacgccctcggcctcaccatcggcgaggcctacggc
cagaccgagtgcaacctcgttctcgcctccagcgcccggatcggcgtggcgcgggccggc
gcgacgggcaagccggtgcccggccaccgcgtcgcggtcctgcgcgaggacgggaccgag
gcggacgcggacgagtccggcgagatcgccgtgcgcgcccccgatccggtgctgttcctc
ggctactggcgccagcccgaggcgaccgccaagaaatttcgcgacggctggtggatgact
ggcgaccaggcgcggcgcgacgccgacggctacatccgctttgtcggccgcgaagacgat
ctcatcacctcggcggcctaccggatcggaccggccgagatcgaggcctgcctctgcgcc
catccggcggtggccctcgccgccgcggtcggcgtgcccgatccgctgcgcaccgagacc
gtgaaggccttcgtcaccctgcgcgcgggtttttcgccatccgacgcgctggccgcagaa
atcctcgccttcgccaaggcccggctctccgcccacgaggtgccgcgcgcgctcgcgttt
cgcgacaccctgccgatgacgacgagcggcaagatcatccggcggcagttgcgggacgag
ccggcctaa

DBGET integrated database retrieval system