KEGG   Methylobacterium extorquens DM4: METDI5482Help
Entry
METDI5482         CDS       T00947                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    METDI5482 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    METDI5482 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    METDI5482 (trpA)
Enzymes [BR:mdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     METDI5482 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5434549..5435391)
Genome map
AA seq 280 aa AA seqDB search
MTARIDAAFARCRAEGRAALVTYVMAGDPDPETSLKVLEALPKAGADIVEFGLPFTDPMA
DGPAIQAAGLRALKAGQDLRGTLALVRRFREGDDRTPVVLMGYYNPIHTYGVPYFLEDAQ
AAGIDGLIVVDLPPEEDEELCLPALEKGLAFIRLATPTTDEARLPAVLANTAGFVYYVSI
TGVTGTATPDFGRVSQAVSRITAHTNLPVVVGFGVKTGAHAAEIARGADGVVVGSALVDA
LARSLEPGDRAGNGTVEAVTSLVRELAQGVRSAAKAPAGS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcatcgatgccgccttcgcccgctgccgcgcggaaggacgtgccgccctc
gtcacctacgtgatggccggcgatcccgatccggagacctcgctcaaggtgctcgaagcc
ctgccgaaggcgggggccgacatcgtcgagttcggcctgcccttcaccgatcccatggcc
gacgggccggcgatccaggcggcgggtctgcgggcgctgaaggcgggccaggatctgcgc
ggcaccctcgccctcgtccgccgcttccgcgaaggcgacgaccggacgcccgtggttctg
atgggctactacaacccgatccatacctacggcgtgccctactttctggaggacgcgcag
gcggccggcatcgacggtctgatcgtcgtcgatctgccgccggaggaggacgaggagctc
tgcctgccggcgctcgaaaaggggctcgccttcatccgactcgcgaccccgaccacggac
gaggcccgcctgccggcggttctcgcgaacaccgcgggcttcgtctactacgtgtcgatc
accggcgtgaccggcacggcgacccccgatttcggccgggtgtcgcaggcggtcagccgg
atcacggcgcatacgaacctgcccgtcgtcgtcggcttcggcgtgaagaccggcgcgcac
gcggccgagatcgcccgcggcgccgacggcgtggtggtgggctcggccctcgtcgatgcg
ctggcccgcagcctcgagcccggcgaccgggccgggaacggcacggtggaggcggtcacc
tccctggtgcgcgaactggcgcagggggtccgcagcgccgccaaggcgccggccgggtcc
tga

DBGET integrated database retrieval system