KEGG   Methylobacterium extorquens DM4: METDI5482Help
Entry
METDI5482         CDS       T00947                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20 4.1.2.8)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mdi01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mdi00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mdi00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5434549..5435391)
Genome map
AA seq 280 aa AA seqDB search
MTARIDAAFARCRAEGRAALVTYVMAGDPDPETSLKVLEALPKAGADIVEFGLPFTDPMA
DGPAIQAAGLRALKAGQDLRGTLALVRRFREGDDRTPVVLMGYYNPIHTYGVPYFLEDAQ
AAGIDGLIVVDLPPEEDEELCLPALEKGLAFIRLATPTTDEARLPAVLANTAGFVYYVSI
TGVTGTATPDFGRVSQAVSRITAHTNLPVVVGFGVKTGAHAAEIARGADGVVVGSALVDA
LARSLEPGDRAGNGTVEAVTSLVRELAQGVRSAAKAPAGS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcatcgatgccgccttcgcccgctgccgcgcggaaggacgtgccgccctc
gtcacctacgtgatggccggcgatcccgatccggagacctcgctcaaggtgctcgaagcc
ctgccgaaggcgggggccgacatcgtcgagttcggcctgcccttcaccgatcccatggcc
gacgggccggcgatccaggcggcgggtctgcgggcgctgaaggcgggccaggatctgcgc
ggcaccctcgccctcgtccgccgcttccgcgaaggcgacgaccggacgcccgtggttctg
atgggctactacaacccgatccatacctacggcgtgccctactttctggaggacgcgcag
gcggccggcatcgacggtctgatcgtcgtcgatctgccgccggaggaggacgaggagctc
tgcctgccggcgctcgaaaaggggctcgccttcatccgactcgcgaccccgaccacggac
gaggcccgcctgccggcggttctcgcgaacaccgcgggcttcgtctactacgtgtcgatc
accggcgtgaccggcacggcgacccccgatttcggccgggtgtcgcaggcggtcagccgg
atcacggcgcatacgaacctgcccgtcgtcgtcggcttcggcgtgaagaccggcgcgcac
gcggccgagatcgcccgcggcgccgacggcgtggtggtgggctcggccctcgtcgatgcg
ctggcccgcagcctcgagcccggcgaccgggccgggaacggcacggtggaggcggtcacc
tccctggtgcgcgaactggcgcagggggtccgcagcgccgccaaggcgccggccgggtcc
tga

DBGET integrated database retrieval system