KEGG   Methylobacterium extorquens DM4: METDI5482Help
Entry
METDI5482         CDS       T00947                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00260  Glycine, serine and threonine metabolism
mdi00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mdi01100  Metabolic pathways
mdi01110  Biosynthesis of secondary metabolites
mdi01130  Biosynthesis of antibiotics
mdi01230  Biosynthesis of amino acids
Module
mdi_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    METDI5482 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    METDI5482 (trpA)
Enzymes [BR:mdi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     METDI5482 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PA ThiG PcrB
Motif
Other DBs
NCBI-ProteinID: CAX27090
UniProt: C7CMU5
Position
complement(5434549..5435391)
Genome map
AA seq 280 aa AA seqDB search
MTARIDAAFARCRAEGRAALVTYVMAGDPDPETSLKVLEALPKAGADIVEFGLPFTDPMA
DGPAIQAAGLRALKAGQDLRGTLALVRRFREGDDRTPVVLMGYYNPIHTYGVPYFLEDAQ
AAGIDGLIVVDLPPEEDEELCLPALEKGLAFIRLATPTTDEARLPAVLANTAGFVYYVSI
TGVTGTATPDFGRVSQAVSRITAHTNLPVVVGFGVKTGAHAAEIARGADGVVVGSALVDA
LARSLEPGDRAGNGTVEAVTSLVRELAQGVRSAAKAPAGS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcccgcatcgatgccgccttcgcccgctgccgcgcggaaggacgtgccgccctc
gtcacctacgtgatggccggcgatcccgatccggagacctcgctcaaggtgctcgaagcc
ctgccgaaggcgggggccgacatcgtcgagttcggcctgcccttcaccgatcccatggcc
gacgggccggcgatccaggcggcgggtctgcgggcgctgaaggcgggccaggatctgcgc
ggcaccctcgccctcgtccgccgcttccgcgaaggcgacgaccggacgcccgtggttctg
atgggctactacaacccgatccatacctacggcgtgccctactttctggaggacgcgcag
gcggccggcatcgacggtctgatcgtcgtcgatctgccgccggaggaggacgaggagctc
tgcctgccggcgctcgaaaaggggctcgccttcatccgactcgcgaccccgaccacggac
gaggcccgcctgccggcggttctcgcgaacaccgcgggcttcgtctactacgtgtcgatc
accggcgtgaccggcacggcgacccccgatttcggccgggtgtcgcaggcggtcagccgg
atcacggcgcatacgaacctgcccgtcgtcgtcggcttcggcgtgaagaccggcgcgcac
gcggccgagatcgcccgcggcgccgacggcgtggtggtgggctcggccctcgtcgatgcg
ctggcccgcagcctcgagcccggcgaccgggccgggaacggcacggtggaggcggtcacc
tccctggtgcgcgaactggcgcagggggtccgcagcgccgccaaggcgccggccgggtcc
tga

DBGET integrated database retrieval system