KEGG   Methylobacterium extorquens DM4: METDI5716Help
Entry
METDI5716         CDS       T00947                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    METDI5716 (tpiA)
   01230 Biosynthesis of amino acids
    METDI5716 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    METDI5716 (tpiA)
   00051 Fructose and mannose metabolism
    METDI5716 (tpiA)
   00562 Inositol phosphate metabolism
    METDI5716 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    METDI5716 (tpiA)
Enzymes [BR:mdi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     METDI5716 (tpiA)
Exosome [BR:mdi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   METDI5716 (tpiA)
  Exosomal proteins of bladder cancer cells
   METDI5716 (tpiA)
  Exosomal proteins of melanoma cells
   METDI5716 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5700663..5701427)
Genome map
AA seq 254 aa AA seqDB search
MASEGRRPLVAGNWKMNGLLSSVPTVEAIRDGLSPALADKIDVLICPPATLISSCVAAVY
GSVVAIGGQNLHARPSGAFTGSISAEMFADLGATYVIVGHSERRAYHYETDDGVHAKALG
ARRAGLRGIICVGETMEERQQGRALDIVRAQLAIGLPKGATGADTVIAYEPVWAIGSGRT
PTATEIAEVHASLREMLDKLVGEEAHKIRILYGGSVKPSNARELMAVENVDGALVGGASL
VAEDFLGICRAYEG
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcgagggacgccgtccgctggttgccggcaactggaagatgaacggtctgctc
tcctcggtcccgaccgtcgaggcgatccgtgacgggctctcgccggcgctcgcggacaag
atcgacgtgctgatctgcccgcccgcgacgctgatctcctcctgcgtggcggcggtctac
ggctccgtcgtcgccatcggtggccagaacctgcacgcccggccgagcggtgccttcacc
ggttcgatctcggcggagatgttcgccgatctcggcgccacctacgtcatcgtcggccat
tccgagcggcgcgcctaccattacgagaccgatgacggcgtccatgccaaggcgctgggc
gcccggcgcgcgggcctgcgtggcatcatctgcgtcggtgagacgatggaggaacgccag
cagggccgggcgctcgacatcgtgcgcgcgcagctcgccatcggcctgccgaagggtgcg
accggcgccgacaccgtgatcgcctacgagccggtctgggcgatcggctcgggccgcacg
ccgacggcgacggagatcgccgaggtccacgcctccttgcgcgagatgctcgacaagctc
gtcggcgaggaggcgcacaagatccgcatcctctacggcggctcggtgaagccctcgaac
gcccgcgaactgatggcggtggagaacgtcgacggcgcgctggtcggcggcgccagcctc
gtggcggaggactttttggggatctgccgcgcttacgaggggtga

DBGET integrated database retrieval system