KEGG   Methylobacterium extorquens DM4: METDI5781Help
Entry
METDI5781         CDS       T00947                                 

Gene name
matA
Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    METDI5781 (matA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    METDI5781 (matA)
Enzymes [BR:mdi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     METDI5781 (matA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5767473..5768882
Genome map
AA seq 469 aa AA seqDB search
MAAISFLGDLIQTISDRGRDLIGLARSDLARTASAADLARFCEDLISRRGEASGVALARL
ILDRYAAFPLEDRLAFLELVATEFGADHDAVDAAIAAYRADPTRARLGLLHVAAEPRSQE
LIRRLNLARGGTLALVRMREDLFTLRKRLKDREAAPETIDAAVSLDSDFEHLFASWFNRG
FLVLRPIDWSTPADILEKIIRYEAVHEIADWDELRRRIQPTDRRCFAFFHPALLDEPLIF
VEVALTNAIAPAIQPILADGREPVPARSATTAIFYSISNCQKGLAGVTFGNFLIKQVVED
LAREIPSLKTFVTLSPVPGFRTWLDRERGADAPQGLTREDVEALRLLDTEDWRSDKTKCE
AVRRAMLPAAAAYFLRAKNEKGRPLDPVARFHLGNGARLERMNFLGDTSKKGLKQSYGLM
VNYLYDLSAIEKNHETYVNLGTVATSSAVSRELRSNLPPPRAVVLAEAG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgatctcgttcctcggcgatctcatccagaccatcagtgaccggggccgggac
ctcatcggcttggcccgctccgatttggcgcggacggcgagcgcggcggacctcgcccgg
ttctgcgaagacctgatttcccggcgcggcgaagcctcgggcgtcgcgctcgcgcgcttg
atcctcgatcgctacgccgcctttccccttgaggaccggcttgccttcctagaactcgtt
gccaccgaattcggtgccgaccatgacgcggtcgatgctgcgatcgccgcttaccgtgct
gacccgacgcgggcccgtctcggtctgttgcacgtggcggccgagccgcgctcgcaggaa
ctgattcggcggctcaacctcgcccgcggcggcaccctcgcgctggtgcggatgcgcgag
gatctgttcacgctgcgcaagcgcctgaaggatcgggaagccgccccggagacgatcgac
gcggcggtgagcctcgacagcgatttcgagcacctgttcgcctcttggttcaatcggggc
ttcctcgttttgcgcccgatcgactggtcgacgccggccgacatcctcgagaagatcatc
cgctacgaggcggtccacgagatcgccgattgggacgaattgcgccgccgcatccagccg
acggaccggcgctgcttcgccttcttccacccggccctgctcgacgagccgctgatcttc
gtcgaggtcgcgctcaccaacgccatcgctccggcgatccagccgatcctggccgacggg
cgcgaaccggtgcccgcgcgcagcgccacgaccgcgatcttctactcgatctcgaactgc
cagaagggcttggccggcgtcaccttcggcaacttcctcatcaagcaagtggtcgaggat
ctcgctcgcgagattccctcgctgaagaccttcgtcaccctttcgccggtgcccggcttc
cgcacctggctcgaccgggagcgtggcgccgacgcgccgcagggcctgacgcgggaggat
gtcgaggcgctgcgactgctcgataccgaggattggcgcagcgacaagacgaagtgcgag
gcggtgcggcgcgccatgctgcccgcggcggcggcctatttcctgcgcgccaagaacgag
aagggccgcccgctcgatccggtggcccgcttccatctcggcaacggcgcccggctggag
cggatgaactttctcggcgacacttcgaagaagggtctgaagcagtcctacggtctgatg
gtgaactacctctacgacctctcggcgatcgagaagaaccacgagacctacgtcaatctc
ggcacggtcgcgacctcgtcggccgtcagccgcgaactgcgctccaacctgccgccgccg
cgggcggtggtgctggcggaggcgggctaa

DBGET integrated database retrieval system