KEGG   Methylobacterium extorquens DM4: METDI5783Help
Entry
METDI5783         CDS       T00947                                 

Gene name
hbd
Definition
(GenBank) D-beta-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mdi  Methylobacterium extorquens DM4
Pathway
mdi00072  Synthesis and degradation of ketone bodies
mdi00650  Butanoate metabolism
mdi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdi00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    METDI5783 (hbd)
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    METDI5783 (hbd)
Enzymes [BR:mdi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     METDI5783 (hbd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 Pox_E2-like
Motif
Other DBs
NCBI-ProteinID: CAX27384
UniProt: C7CA23
Position
complement(5769529..5770314)
Genome map
AA seq 261 aa AA seqDB search
MSLQGKAAVVTGSTSGIGLAIAKSFAKDGANVVLNGFGNPEDIERTRSGIESEFGVKAVY
SPADLTKPDEIGGLIALSVETFGSIDILVNNAGIQYVSPIEDFPVEKWDQIIALNLCSAF
HTLRAAVPHMKANGWGRVINTASAHSMVASPYKSAYVAAKHGVVGLTKTAALELATHGIT
VNCISPGYVWTPLVESQIPDTMKARGLTKEQVIEEVLLKAQPTKEFVTIDQVAALALFLC
TDSASQITGANIAMDGGWTAQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgcaagggaaagccgccgtggtcaccggctcgacgagcggcatcggcctcgcc
atcgccaagagcttcgcgaaagacggcgcgaacgtggtcctcaacggattcggcaacccc
gaggacatcgagcggacccgcagcggcatcgagagcgagttcggggtcaaggcggtctac
tcgcccgccgacctcaccaagccggacgagatcggcgggctgatcgcactctcggtcgag
acgttcggcagcatcgacatcctcgtgaacaatgcgggcatccaatacgtctcgccgatc
gaggactttccggtcgagaagtgggaccagatcatcgccctcaatctctgctcggccttc
cacaccctgcgtgcggccgtgccgcacatgaaggcgaatggctggggccgggtcatcaac
acggcttcggcccactcgatggtcgcctcgccctacaagtcggcctacgtcgcggccaag
cacggcgtcgtcggcctcaccaagacggcggcgctcgaactcgccacccacggcatcact
gtgaattgcatctcaccgggctatgtctggacgccgctggtggagagccagatcccggac
acgatgaaggcgcgcggcctcaccaaggagcaggtgatcgaggaggtgctgctcaaggcg
cagccgaccaaggaattcgtgacgatcgatcaggtggccgcgctcgccctgttcctgtgc
acggacagcgccagccagatcaccggtgccaacatcgccatggatggcggctggacggcg
cagtag

DBGET integrated database retrieval system