KEGG   Malus domestica (apple): 103439640Help
Entry
103439640         CDS       T03194                                 

Definition
(RefSeq) beta-fructofuranosidase, soluble isoenzyme I-like
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
mdm  Malus domestica (apple)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103439640
   00500 Starch and sucrose metabolism
    103439640
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103439640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
7
AA seq 645 aa AA seqDB search
MDTTNNTSYTPLPGEDPSAAVPPPTHRRPFKGFAVIFSSVIFLLSFVTLVIHQGPGAPPK
TVPEQPDHHHQYRPASTSSETRSFSVPRGKLEGVSAKSYPHFSEEASYNWTNAMFSWQRT
AFHFQPEKNWINDPNGPLFHKGWYHLFYQYNPDSAVWGNITWGHAVSTDMIHWLYLPLAM
VPDRWFDANGVWTGSATLLPDGQIIMLYTGSTNDSVQVQNLAYPANLSDPLLLDWVKYEG
NPILTPPSGIGSTDFRDPTTAWIGPDGKWRTTIGSKFNKTGISMVYTTTDFINYELHDGV
LHEVPGTGMWECVDFYPVAINGSKGLDTSVNNGGVKHVLKASLDDTKLDHYAIGTYFIEN
ETWVPDDPTIDVGIGLKYDYGRYYASKTFYDQNKERRILLGWINETDTETDDLKKRWASL
HTIPRTVLFDSKTGTNLLQWPVEEIEDLRLNSTEFTDVLVEAGTVVPLDIGTATQLDIFV
DFEIELLDTEESVNGSSGCGDGAVDRSTFGPFGILVIADESLSELTPVYFRVTNSTDGDV
TTYFCADESRSSKAPEVFKQVYGGEVPVLDGETYSARVLVDHSIVESYAQGGRTVISSRV
YPTEAIYGAARLFLFNNATGVNVKATLKIWQLNSAFIHPFPLDQI
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaccaacaacacttcctacactcccttgccgggggaagacccctccgccgcc
gtccctccgccgacccatcggagaccctttaagggttttgccgtgatattctcctccgtc
atatttctcttgtcatttgtcacattagttatccaccaaggaccgggggcgccgccaaaa
acagtgccagaacaaccggatcaccaccaccaatacaggccagcttcaaccagttcagag
acgaggtcgttttcagtgcctcgaggaaaattagaaggagtatcggccaaatcgtaccct
catttttcagaggaagcttcatataattggacaaatgccatgttttcctggcaaagaact
gcattccatttccagccagaaaaaaattggataaatgatccgaatgggccgttgtttcac
aagggatggtatcacctgttctaccagtacaacccggactcagctgtgtggggcaacatc
acatggggccatgcggtatcaacggacatgattcactggctctacctcccgctcgccatg
gtccccgatcgatggttcgatgcgaacggagtgtggaccgggtccgccaccctcctccct
gacggccaaatcataatgttgtacactggcagcaccaatgattccgtgcaagtacaaaac
ctcgcctaccctgccaacctatcggatccccttttacttgattgggtcaagtacgaaggt
aatccgattttaactccgccatccgggatcggatccactgatttccgtgaccccacaacc
gcgtggattggtcccgatggcaaatggcgaactaccattggatcaaaattcaacaaaact
ggaatttcaatggtgtacaccaccactgattttataaactatgagctccatgatggggtc
ttgcatgaggtcccgggtacgggtatgtgggagtgcgtggacttttacccggttgctata
aacgggtccaagggtttggacacgtcggtaaacaacggcggagttaagcacgtgctgaag
gctagtttggatgacacaaaattggatcattacgcaattgggacttattttatagagaat
gagacatgggtacccgatgacccgactatcgacgttggtatcgggttgaagtatgactat
ggaaggtactatgcatcaaagacattttatgatcaaaataaggagagaaggatcttgttg
ggttggattaatgaaactgacactgagactgatgatttgaagaaacgttgggcttccctt
cacaccattccgaggacggtgttgtttgatagcaaaactggaaccaatttgcttcaatgg
ccggtggaggagattgaagacttgagattaaacagtaccgaatttactgatgttttggtt
gaagcaggaacagttgtgccacttgatattggaactgccacacagttggacatattcgtc
gactttgaaatcgagttattggacacagaggagagcgtgaatgggagttcagggtgtggt
gatggtgctgtagataggagcacattcggaccctttggcattttggtcattgcagatgaa
tctctttccgagttaaccccggtttattttcgagttaccaactcgaccgatggggacgtc
acgacttacttctgcgccgacgaatcgaggtcctccaaggctcctgaagtcttcaaacaa
gtttatggaggcgaagttcctgtgttggatggtgaaacttattctgccagagtgttggtt
gatcattcgatcgtggaaagctacgcgcaagggggcaggacggtaatttcatcgcgggtt
tacccgacagaagcaatctatggagcagcaaggctgttcttgttcaacaatgcaacagga
gtgaatgtcaaggctaccctcaagatttggcagctcaactcagccttcattcatcctttc
ccattagaccagatttaa

DBGET integrated database retrieval system