KEGG   Malus domestica (apple): 103453569Help
Entry
103453569         CDS       T03194                                 

Gene name
CWI
Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
mdm  Malus domestica (apple)
Pathway
mdm00052  Galactose metabolism
mdm00500  Starch and sucrose metabolism
mdm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    103453569 (CWI)
   00500 Starch and sucrose metabolism
    103453569 (CWI)
Enzymes [BR:mdm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     103453569 (CWI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 103453569
NCBI-ProteinID: NP_001280910
UniProt: K4HUT0
Position
13
AA seq 577 aa AA seqDB search
MAISSLFLYCFLCLWLGHAVLRLEASHHVYRSLQTYSELTSSHHHPDTEPYRTGYHFQPP
KNWINDPNGPLIYKGIYHLFYQYNPKGVVWGNIVWAHSTSTDLVNWTPHDAAIFPSQPSD
INGCWSGSATILPSGKPVILYTGINPQNQQVQNLAYPKNLSDPFLREWVKVPQNPLMAPT
QANHINASSFRDPTTAWLGPDKRWRVIIGSKQNQRGLAILYRSKDFLSWVKAKHPLHSAK
KTGMWECPDFFPVSIHGQNGLDSSENGPAVKHVLKASLDNTKHEYYTIGTYNIDKDIYIP
DKGSVESDSGLRYDYGKFYASKTFFDSSKNRRILWGWINESSSVEGDIKKGWSGLQAIPR
TLWLAKSGKQLVQWPVQEIEKLRGKTVKLPSTVLKGGSVREVVGVTAAQADVEITFGISD
FKKAEVLDPSWTDPQLLCGQKSATVKGSLGPFGLYVLASKDLKEYTAVFYRIFKANNKYV
VLLCSDQSRSSLNKDNDKTTYGAFVKVDPLREKLSLRNLIDHSIVESFGGEGKACITARV
YPTLAIDDDAHLYAFNYGTEDVKITGSAWSLKTAKIN
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggccatctcctctctctttctctactgctttctctgtctttggctaggccatgctgtt
cttcggcttgaagcttcccaccatgtttacagaagccttcaaacttattccgagctaact
tcctcacatcatcacccagatactgaaccctacagaactggttatcatttccaacctccc
aagaactggatcaatgatcctaatggaccattgatttacaagggaatttaccatctcttc
tatcaatacaaccctaaaggtgtggtttgggggaacattgtgtgggctcattccacatca
actgatcttgttaactggaccccacatgatgctgccatcttcccatcgcagccgtccgat
atcaacggctgttggtcgggttccgccaccatcctcccgagtggcaaaccggtcattttg
tataccggaatcaacccccaaaaccagcaggttcagaatttggcctatcccaagaacctc
tcagacccatttcttagggagtgggtcaaggtcccacaaaatcccctaatggcacccacc
caagctaaccatatcaacgcaagctcatttagggaccccacaactgcttggttgggccca
gataagagatggagagtgatcattggaagcaagcagaaccaaagaggattagctatccta
tacaggagtaaagatttcctttcttgggttaaggccaaacacccccttcactcagccaag
aaaactggaatgtgggaatgtccagattttttcccagtttcaatccatggccagaatggt
cttgactcatcagaaaatggtcctgctgtcaaacatgtgctcaaggctagcctggataac
actaaacatgagtactacacaattgggacttataacattgacaaggatatatatattccg
gataagggttcagtggagagtgactcaggcttgagatatgattatggaaagttttatgct
tcaaaaactttctttgacagttctaagaatcggaggatattgtggggttggattaatgaa
tcgtcgagcgtcgagggtgatatcaagaagggatggtctggacttcaggcaattccaaga
accctatggctcgccaaatccgggaaacagttggtgcaatggccagtacaagaaattgaa
aagctacgtggaaaaacggtcaagttgccaagcactgtgcttaagggaggatcggtgcgt
gaggtagttggtgtcactgcagcacaggcagatgtggagattacattcggaataagtgat
tttaagaaagcagaagttcttgaccctagttggacggacccccaacttttgtgtggccaa
aaaagtgccacagttaaaggtagtttaggaccatttggactgtatgttttggcttccaag
gacttgaaagaatacacagcagtgttctatagaatattcaaagccaataacaaatatgtg
gtgctcctctgcagtgatcaaagccggtcttccttaaataaggataatgataagaccact
tatggagcttttgtaaaggtggatcctcttcgtgagaagctgtcgctaagaaatttgatt
gatcactcaattgtggagagctttggtggagaaggcaaggcgtgcataacagctagggtt
tatcccacattggccattgacgatgatgctcacttgtatgccttcaattatggaacagaa
gatgtaaaaatcacagggagtgcatggagcttgaaaacagcaaaaatcaattga

DBGET integrated database retrieval system