KEGG   Monodelphis domestica (opossum): 100009830Help
Entry
100009830         CDS       T01031                                 

Gene name
PRKX
Definition
(RefSeq) protein kinase, X-linked
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100009830 (PRKX)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   100009830 (PRKX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 384 aa AA seqDB search
MEAAGCAAKAAKVGAGNGGSEGNPPPPPPPPPPPPAPPGSSGSGDSEPAHSSSPAVGPGS
PAPSPELPAYKLQDFDTLATVGTGTFGRVHLVKERTAKHYFALKVMSIPDVIRLKQEQHV
HNEKSVLKEVSHPFLIRLYWTYHDERFLYMLMEYDPGEYLFSYVRDMGRFNNSTGLFYSA
EIICAIEYLHSKEIVYRDLKPENILLDKEGHIKLTDFGFAKKLLDRTWTLCGTPEYLAPE
VIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDLYVKDL
IKKLLVVDRTRRLGNMKNGADDVKKHRWFRSVDWDAVPQRKLKPPIVPKVSNDGDTSNFE
AYPEDDWNKMPPVPPKDLEIFKNF
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atggaggctgctgggtgcgcggcgaaagcggccaaggtcggggcaggaaatgggggcagc
gaagggaatcctcctcctcctccccctccccctccccctcctccggctcctccggggtcc
tcggggtcgggggattcggagcccgcccattcctcgagccccgcggtgggcccgggctct
ccagctccttcgcccgagcttccagcttacaagcttcaggacttcgatactctggctacc
gtgggcacaggtacctttgggcgagttcacctagtcaaagaaagaacagccaagcattat
tttgcattgaaggtaatgagcattccggatgtcattcggctaaagcaagagcagcacgta
cacaatgaaaagtcagttctgaaagaagtcagtcatccatttctgatcagattatactgg
acctatcatgatgaaagatttttatacatgttaatggaatatgatcctggagaatacctc
ttcagctacgtgagagacatgggacggttcaataacagcacaggactattttattctgca
gagattatctgtgcaatagaatatctgcactccaaagaaatagtttacagagatctaaaa
cctgaaaatatattgttagataaagaaggtcatatcaagctcacagattttggatttgct
aaaaagctattagataggacatggacactctgtgggacaccagaataccttgctcctgaa
gtcatacaaagtaaaggtcatggaagagcagtagattggtgggctttggggattctgatc
tttgagatgctctctgggtttcctccattttttgatgacaacccatttggcatctatcaa
aaaattcttgcaggcaaaatagatttccctaggcatttggatctctatgtaaaagacctt
attaagaaacttcttgttgtagacaggacaagacgactggggaacatgaagaatggagca
gatgatgtgaaaaagcaccggtggttcaggtctgtggactgggatgctgtaccccagaga
aaactaaagcctcctatagtgccgaaggtatccaatgatggtgatacatctaattttgaa
gcttatcctgaagatgactggaacaagatgccacctgtgcctcctaaagacttagaaatc
tttaagaatttctga

DBGET integrated database retrieval system