KEGG   Monodelphis domestica (opossum): 100009833Help
Entry
100009833         CDS       T01031                                 

Gene name
MGAM
Definition
maltase-glucoamylase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mdo00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mdo00500]
Organismal Systems; Digestive system; Carbohydrate digestion and absorption [PATH:mdo04973]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 3674 aa AA seqDB search
MIYLANSGFPWFFDLWGNLFSLLLGCAHVRNTLVQECVLWPLKLKHDLMFEMGKKNFSKL
EIILSFLLFILFIISVALIVILATNTSSVNDGSFVNTTSSPQTTIASSIVNSTTTSQTTT
IAAECPAANQSERINCIPDQTPTQTTCSQRGCCWSPQGPENIPLCYFPKKYGYQIRNSTY
SRTGFTAHLNRLPTPSMFGNDIANVILTAEYQTANRFHFKISDPSEARYEVPHEHVQLFP
GNATSNLNYHVDCVEEPFSIKVTRKSNNRVLFDTGIGPLQFAQQYLQLSIQLPSANVYGL
GEHVHQQYRHDMDWKTWPIFSRDTTPNEDMTNLYGAQTFFLCLEDTSGASFGVFLMNSNA
MEVTLQPAPAITYRVIGGVLDFYVFLGNTPEEVVREYLELIGRPFLPSYWSLGFHLSRWV
YGGLDGMKKVVERNRAAQLPCDVQYSDIDYMDEKKDFTYDKVLFNGLPEFVEDLHNHGQK
YVIIMDPAIFINSSNYGPYIRGSDMKIWVNASDGVTPLIGMVWPGQTVFPDYTNPKCAQW
WAEEFRLFYRELKFDGIWIDMNEPSNFENGSSIGCSHNTLNSPPFIPRILDRYLPSKTLC
MDAVQHWGKHYDVHSLYGYSMAIATEEAVKTVFPNKRSFIVTRSTFAGSGKFAAHWLGDN
AATWNDLRWSLPGMLEFNLFGIPMVGPDICGFTYNVSEELCRRWMQLGAFYPFSRNHNGE
GYKDQDPAAFGKDSLLLNSSRHYLNIRYTLLPYLYTLFFRAHTRGDTVARPLLHEFYEDS
NTWAVYRQFLWGPGLLITPVLDEGAKNVTAYLPDAVWYDYETGGQIPERKQQVEMLFSPE
QIGLHLRGGYIFPIQQPAITTVASRKNPLGLIIAPDDNKEARGELFWDDGETKGTIASGS
YILHEFLFTQNRLDMKVLHQSYNDPNNLAFEEIKILGTEEPTNITVKKNNVPIASSPNVT
YFEKDRVAMISGLELALGEEYTVEWSIKFREVIKIDCYPEDQAVSEENCTARGCAWELSN
SPGVPNCYVINHLYSVSSIQYNPTGITADIFLNSPVRASNLLSAGLSTPVNPLRLDVTYH
KNDMLQFKIYAANSKRFEVPVPLNIPSSPSSTAENRLYEVLIKRDPFGIEIRRRSTGTII
WDSQIPGFTFNDMFLRISTRLPSQYVYGFGETEHTTFRRNLTWHTWGMFSRDQPPEYKKN
SYGVHPYYMGLEDDGKAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTPELV
TQQYTELVGRPVMTPYWALGFQLCRYGYQNDAEIAELYDAMVAAQIPYDIQYSDIDYMER
QLDFVLSSKFAGFPDLINRMKEAGMRVILILDPAISGNETQPYPPFLRGVEDDVFIKWPD
DNGIVWVKVWPDLPNVTVNTSLDWDTQVELYRAHVAFPDFFRNSTVKWWKRELLELYNNP
QEPEKSLKYDGLWIDMNEPSSFVNGAVSPGCRNTTLNHPPYMPYLEARDRGLSSKTLCME
SQQFLPDGSPVTHYDVHNLYGWSQTKPTYEGVQEATGKRGIVISRSTFPSSGRWAGHWLG
DNKSTWDQLYKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFSRNHN
ALGTKRQDPVAWNSTFEDLSRSVLKTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFIEDK
ETWDIFLQFLWGPAFLVSPVLEPNSRQVSAYFPRARWYDYYSGSDIGVRGQWKDLSAPLD
HINLHIRGGYILPWQEPANNTHYSRRNSLGLLVALSDNGTAEGEFFWDDGESIDTYEKGN
YYFSTFSASEKHLDVKVFQQNYQDPNHLAFKEIKIFGLNFQPFLVTVKENNIPIQSDAEI
KYDPATKVTHITRLNLELGKEYTVEWSTKFRDTEKFDCYPDADGAQEEKCKLRDCVWEPT
NSTGVPFCYITKYYYTASNIQNTGVGLTADISRNAEVNHYPSTPINQLRLDVTFHKNHML
QFKIYDANNKRYEVPVPLNTPNSPTSQPENRLYEVTIKENPFGIEIRRKSTGTVIWDSQV
PGFTFNDMFLRISTRLPSHYIYGFGETEHTTFRRDLNWHTWGMFSRDQPPGKNSYGVHPY
YMGLEEDSNAHGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVTQQYTEL
IGRPVMTPYWALGFQLCRYGYENDNEIAELYDAMVAAQIPYDVQYSDIDYMERQLDFTLS
PKFAGFPDLISRMKDAGMRVILILDPAISGNETKPYPAFTQGVQQDVFIKWPNEDSIVWG
KVWPDLPNVTINGSLDWDTQVELYRAHVAFPDFFRNSTVQWWKQELRELHTNSREPEKSL
KFDGMWIDMNEPSSFVNGAVPPGCRNDTLNHPPYMPRKDRGLSSKTLCMESQQILPDGSP
VRHYDVHNLYGWSQTKPTYEGVQEATGKRGIVISRSTFPSSGRWAGHWLGDNTAAWDQMY
KSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWTQLGAFYPFSRNHNTIGPRRQDPV
SWNSTFEDLSRDVLNIRYTLLPYLYTLMHKANVEGSTVVRPLLHEFVEDKETWDLFHQFL
WGPAFLISPVLEHNARNVNAYFPNARWYDYYTGSDIGVRGQWKDLSAPLDYINLHIRGGY
ILPWQEPANNTHYSRRNSLGLLVALSDNGTAEGEFFWDDGESIDTYEKGNYYFSTFSASE
KHLDVKVFQQNYQDPNNLAFKEIKIFGLNFQPLLVTVKENNIPIQSDAEIKYNPATKVTH
ITRLNLELGKEYTVEWSTKFRDTEKFDCYPDADGAQEEKCKLRDCVWEPTNSTGVPFCYI
TKYYYTASNIQNTGVGLTADISRNAEVNHYPSTPINQLRLDVTFHKNHMLQFKIYDANNK
RYEVPVPLNTPNSPTSQPENRLYEVAIKENPFGIEIRRKSTGTVIWDSQVPGFTFNDMFL
RISTRLPSHYIYGFGETEHTTFRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYMGLEEDS
NAHGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTPELVTQQYTELIGRPVMTP
YWALGFQLCRYGYENDNEIAELYDAMVAAQIPYDVQYSDIDYMERQLDFTLSPKFAGFPD
LISRMKGAGMRVILILDPAISGNETKPYPAFTQGVQQDVFIKWPDEDSIVWGKVWPDLPN
VTINGSLDWDTQVELYRAHVAFPDFFRNSTVQWWKKELRELHNNSREPEKSLKFDGMWID
MNEPSSFVNGAVPPGCRNDTLNHPPYMPHLESRDRGLSSKTLCMESQQILPDGSPVRHYD
VHNLYGWSQTKPTYEGVQEATGKRGIVISRSTFPSSGRWAGHWLGDNTAAWDQMYKSIIG
MMEFSLFGISYTGADICGFFQDAEYEMCARWTQLGAFYPFSRNHNTIGPRRQDPVSWNST
FEDLSRDVLNIRYTLLPYLYTLMHKANVEGSTVVRPLLHEFVEDKETWDLFRQFLWGPAF
LISPVLEHNARNVNAYFPNARWYDYYTGEDIGVRKQYKELSAPLDHINLHVRGGYILPWQ
EPAINTRYSREKFMGLTVALDDEGNAKGCLFWDDGESINTYENGDYYFANFSARPNNLEH
HIIHNKYIVATKPLWLGFIHIWGLSIDSITNVTVAQKEHVLTIDNFQHDQARQILAVNLT
AHQITLGHPFVVTW
NT seq 11025 nt NT seq  +upstreamnt  +downstreamnt
atgatatatttagctaattcaggcttcccttggttttttgatctttgggggaatcttttc
tcattgcttctgggttgcgcccatgttcgaaatactcttgtgcaagaatgtgtactttgg
ccgttgaagttaaaacatgaccttatgtttgagatggggaagaagaattttagcaagttg
gagataatcctctcttttctgctcttcatattattcatcatctctgttgctctgattgtg
attttagctacaaatacttcaagtgtgaatgatggctcatttgttaacactacttcaagt
cctcagacaacaatagcctcttcaattgtgaattctactaccacctcccaaactaccaca
attgcagcagaatgccctgcagcaaaccaatcagaaaggatcaactgcatcccagatcaa
acaccaacacagactacgtgttcccagcgtggctgctgctggagcccccaaggaccagaa
aatatacccttgtgctacttccccaagaagtatggctatcagataagaaatagtacatac
tccaggacagggttcactgctcatttgaacagattgcctaccccatcgatgtttggaaat
gatattgccaatgtcatccttacagcagaataccagacagccaaccgtttccacttcaag
atcagtgaccccagtgaagccagatatgaggtacctcatgaacacgtccaactgtttcct
ggaaatgcaacttctaatttgaactatcatgtggattgtgttgaggagccatttagcatc
aaagttacccggaaaagcaacaatcgtgttttatttgacactggtattggacccctccag
tttgctcagcaatacttgcagctctctatccagttaccaagtgctaatgtgtatggctta
ggggagcatgtacaccagcaatatcgtcatgacatggactggaagacttggcccatcttc
tctcgggatactactcctaatgaagacatgactaacttgtatggtgctcaaacatttttc
ttgtgccttgaagatacaagtggagcatcctttggggtttttctgatgaacagcaatgcc
atggaggttacccttcaacctgccccagcaatcacttaccgagtcattgggggtgttctg
gatttttatgtcttcttagggaacactccagaagaggttgttcgggaatatttagagctc
attggaaggccattcttgccatcttactggagtcttggatttcatctcagtcgctgggta
tatggaggtttggatgggatgaagaaagtcgtagagagaaaccgagctgctcaacttccc
tgtgatgttcagtactctgatattgactacatggatgaaaagaaggacttcacttatgat
aaagtactatttaatggacttcctgagtttgttgaggatttacacaaccatggacagaaa
tatgtaattattatggatccagccattttcattaactcttccaactatggtccttacatt
cggggctcagacatgaagatatgggtcaatgcatcagatggagtgacgccactaattggg
atggtgtggccaggccagaccgtctttcctgactataccaatccgaagtgcgctcagtgg
tgggcagaggagttcagactcttctacagggagttaaagtttgatggaatctggattgat
atgaatgaaccctccaactttgaaaatggttcatctataggatgctcacataataccctg
aactctcccccattcattcctagaatactggacagatacctgccttccaagaccctttgc
atggatgcagtacagcactggggcaaacattacgatgtccacagtctgtatggctactca
atggccattgcaactgaagaagctgtaaaaactgtcttccctaataaaagaagctttatt
gtgacacgctctacctttgctggatcgggcaaatttgcagcccattggctgggggacaac
gcagccacttggaatgaccttcgttggtctctacctggcatgctcgaattcaacctgttt
ggtattcctatggttggccctgacatctgtggttttacctataatgtctcagaagaacta
tgcaggcggtggatgcagcttggggcattttatccattttccaggaatcacaacggtgaa
ggctacaaggaccaggatcctgctgcatttggaaaagattcccttcttttgaattcctcc
agacactacctgaacatccgctatactctgctcccctatctctacaccctttttttccga
gctcacactcggggggacactgtagcccggccccttcttcatgagttctatgaagatagt
aacacctgggctgtgtatcggcagtttctgtggggtcctgggcttctcattactcctgtt
ctggatgagggtgctaagaatgtgacagcatacctgcctgatgctgtctggtatgactat
gaaactggaggccaaataccagagagaaaacaacaggtggaaatgctattctcaccagaa
caaattggactccatcttcgaggtggctatattttccccatccagcaaccagccataacc
acagtagccagccgaaagaatcctcttggtctcatcattgcccctgatgacaataaggaa
gctagaggagagcttttttgggatgatggggaaactaaaggtacaatagctagtggttcc
tacatcttgcatgagtttttgttcacccaaaaccgtttggatatgaaggttttgcatcaa
tcctacaatgatccaaataatttagcatttgaagagattaaaatcctcgggacagaagaa
cctaccaacatcactgtgaagaagaataatgtccccattgcatcttctcctaatgtcact
tactttgaaaaggaccgggttgctatgatctcaggacttgaacttgccctgggagaagaa
tacactgtggaatggagtataaaattcagagaggtcatcaaaatagactgttatcctgag
gaccaggcagtctctgaagaaaattgcacagcgcgtggctgtgcctgggagttatctaat
tctccaggagtccctaactgctatgtcatcaatcacctatattctgtcagtagcattcag
tacaacccaacagggatcactgcagatatcttcttaaattcacctgtgcgtgcttccaac
ctgctctctgctgggctctctactcctgtgaaccctctccgcttggatgtcacctaccat
aagaatgatatgctgcagtttaagatctatgctgccaatagcaaaaggtttgaggtcccc
gtgcctctcaacatccccagctctccctctagcaccgctgagaatcggctttatgaagtt
ctcataaagagggatccctttgggattgagatccgacgtcggagcacaggcacaataatt
tgggattcacagattcctggcttcacctttaatgacatgttcctgcgaatctctacccgc
ctcccatcccagtatgtctatggctttggggagacagaacacaccaccttccggagaaac
ttgacctggcatacgtggggaatgtttagtcgagaccaacccccagaatacaagaagaat
tcctatggtgtacatccctattatatgggtctggaggatgatggcaaagcgcatggagtg
ctactactcaatagcaatgccatggatgtgacttttcagcccactcctgcactgacatat
cgcaccactgggggaattctggacttctatatggttttgggaccaaccccagaactcgtc
actcagcagtacacagagttggttgggcggccagtgatgacaccttactgggccttaggg
ttccagctttgtcgttatggataccaaaatgatgctgaaattgctgaactttatgatgct
atggtggcagcccagatcccttacgatatacagtattcagacattgattacatggaacgg
cagttagacttcgtcctcagctccaagtttgctggctttcctgatctgatcaatcgaatg
aaggaagctgggatgagagtcatcctgattctggacccggccatttctggcaatgagacc
cagccatatcctccattccttcggggggtcgaggatgatgtgttcattaaatggccagat
gacaatggaattgtttgggtaaaggtctggccagatttgcccaatgtcactgttaataca
tctcttgattgggacactcaagtggagttatacagagctcatgttgccttcccagacttt
ttccgtaattcaacagtcaagtggtggaagcgggaattgctggaactctacaacaatccc
caggagccagagaagagtctgaagtatgatggactgtggattgacatgaatgaaccgtca
agctttgtgaatggagcagtttctccaggttgcaggaataccacactcaaccaccctccc
tatatgccctatttggaggcaagagatagaggtctgagcagcaaaaccctgtgcatggaa
agtcagcaattcctgcctgatggaagtccagtgacacactatgatgtgcataatctctat
ggctggtcccagacgaagccgacatatgaaggagttcaggaggctacaggaaagagagga
attgtgatcagtcgctcaactttcccttcttctggacgctgggcaggacactggctggga
gacaacaaatcaacatgggaccaactctataagtccatcattggcatgatggagttcagt
ctctttggaatatcctatacaggagctgatatttgtgggttctttcaagatgctgaatat
gaaatgtgtgctcgatggatgcaactgggagccttttacccattctctaggaaccacaat
gctcttgggaccaagaggcaggacccagtggcttggaattctacctttgaggatctctca
agaagtgtccttaagacaagatataccctcttgccatatctctacaccctcatgcacaag
gctcatgttgaaggcagcacagttgtccgaccccttctccatgagtttatagaagacaaa
gaaacctgggacattttccttcagttcttgtggggaccagccttcctagtcagtcctgtc
ctcgaacctaattccaggcaagtgtctgcctacttccccagagctcgttggtatgattac
tactcgggctcagatattggagtgaggggacagtggaaggatctgtcagctcctcttgac
cacatcaatctccatattcgtggaggctacatccttccatggcaagaacctgctaataat
actcattatagccggagaaactccttgggtcttcttgtggctttatcagataatggaaca
gctgaaggagagtttttctgggatgatggagagagtattgatacctatgaaaaggggaat
tactatttctcaacattctctgccagtgagaaacacctggatgtgaaggtttttcagcag
aattaccaagatccaaatcacctggcatttaaagagataaaaatctttggactgaatttc
cagccatttctagttactgtgaaagagaataatattccaatccagtctgatgctgagata
aagtatgatcctgcaacaaaggtcactcacatcactagacttaaccttgagctggggaaa
gagtatacagtggagtggtccacaaagttcagagacacagaaaaatttgactgctaccca
gatgcagatggtgctcaggaagagaaatgtaaattacgtgactgtgtctgggagccaacc
aattctacaggagtccccttttgctacatcactaagtattattatactgccagtaacatt
cagaatacaggagtgggcctaacagcagacatctcccgaaatgcagaagtcaatcactat
ccttccacacccattaaccagctccgattggatgtgacattccataaaaatcacatgcta
cagtttaagatctatgatgccaacaacaagagatatgaagtcccagtgcccttaaatact
ccaaactcccccaccagtcaacctgaaaatcgtctctatgaggtgaccatcaaggaaaac
ccatttggaattgagatccgccgaaaaagcacgggcactgtgatctgggattcccaggtc
cctggctttacctttaatgatatgttcctacgaatctccacccgcctcccatcacactac
atctatggctttggagaaacagagcacacgaccttcaggagggatctaaactggcacact
tggggaatgttttctcgagaccagcctccaggcaagaattcctatggtgtacacccatat
tacatgggtctggaagaggacagcaatgcccatggagtgctcctgctcaacagcaatgcc
atggatgtaactttccaaccaacccctgcactcacatatcggaccatcggaggtattctg
gacttttacatggttttgggacctaccccagagctcgttactcagcagtacacagagttg
attggccggccagtgatgactccttactgggccttaggattccagctgtgtcgttatgga
tacgagaatgataatgaaattgccgaactctacgatgccatggtggctgctcagatcccc
tatgatgtgcagtactcagacattgattacatggagaggcagctagattttaccctcagt
cccaagtttgctggctttcctgatctaatcagtcgaatgaaggatgctgggatgcgagtc
atcctcattctggacccggctatttctggcaacgagaccaagccatatcctgccttcact
cagggagtccagcaagatgtgttcattaaatggcctaatgaagacagcatagtttgggga
aaggtctggccagatttgcccaatgtcactatcaatggatctcttgactgggacacccaa
gtagagttatacagagctcacgttgccttcccagactttttccgtaattcaacagtccag
tggtggaagcaggaattgagggaactgcacaccaattcccgggagccagagaagagcttg
aagtttgatggaatgtggattgacatgaatgaaccatcaagctttgtgaatggggcagtt
cctccaggctgcaggaatgacacactcaatcatcctccttacatgccccgtaaagacaga
gggctgagcagtaagaccctgtgcatggaaagtcagcagatcctgcctgatggaagtcca
gtgaggcactacgatgtgcacaatctctatggctggtcccagacaaagcccacatatgaa
ggtgtgcaggaggctacaggaaagcgaggaattgtgatcagtcgttcaacatttccttct
tcaggacgctgggcaggacattggttgggagacaacacagcagcctgggatcagatgtat
aaatccatcattggtatgatggagttcagtctttttggaatatcctatacaggagctgat
atctgtgggttctttcaagatgctgaatatgagatgtgtgctcgctggacacaactggga
gccttttaccctttctctaggaaccacaataccattgggcctaggagacaagaccccgta
tcttggaattccacctttgaagatctttcaagagatgtcctaaatataagatacactctg
ttgccttatctctacactctgatgcataaggccaacgtagaaggcagcactgttgtccgg
cccctccttcatgaatttgttgaagacaaagaaacttgggacttattccatcaattcttg
tggggtccagccttcttaatcagccctgtcctggaacacaatgcccggaatgtgaatgcc
tacttccccaatgcccgctggtatgattactacacgggctcagatattggagtgagggga
cagtggaaggatctgtcagctcctcttgactacatcaatctccatattcgtggaggctac
atccttccatggcaagaacctgctaataatactcattatagccggagaaactccttgggt
cttcttgtggctttatcggataatggaacagctgaaggagagtttttctgggatgatgga
gagagcattgatacctatgaaaaggggaattactatttctcaacattctctgccagtgag
aaacacctggatgtgaaggtttttcagcagaattaccaagatccaaataacctggcattt
aaagagatcaaaatctttggactgaatttccagccacttctagttactgtgaaagagaat
aatattccaatccagtctgatgctgagataaagtataatcctgcaacaaaggtcactcac
atcactagacttaaccttgagctggggaaagagtatacagtggagtggtccacaaagttc
agagacacagaaaaatttgactgctacccagatgcagatggtgcccaggaagagaaatgt
aaattacgtgactgtgtctgggagccaaccaattctacaggagtccccttttgctacatc
actaagtattattatactgccagtaacattcagaatacaggagtgggcctaacagcagac
atctcccgaaatgcagaagtcaatcactatccttccacacccattaaccagctccgattg
gatgtgacattccataaaaatcacatgctacagtttaagatctatgatgccaacaacaag
agatatgaagtcccagtgcccttaaatactccaaactcccccaccagtcaacctgaaaat
cgtctctatgaggtggccatcaaggaaaacccatttggaattgagatccgccgaaaaagc
acgggcactgtgatctgggattcccaggtccctggctttacctttaatgatatgttccta
cgaatctccacccgcctcccatcacactacatctatggctttggagaaacagagcacacg
accttcaggagggatctaaactggcacacttggggaatgttttctcgagaccagcctcca
ggctacaagaagaattcctatggtgtacacccatattacatgggtctggaagaggacagc
aatgcccatggagtgctcctgctcaacagcaatgccatggatgtaactttccaaccaacc
cctgcactcacatatcggaccatcggaggtattctggacttttacatggttttgggacct
accccagagctcgttactcagcagtacacagagttgattggccggccagtgatgactcct
tactgggccttaggattccagctgtgtcgttatggatacgagaatgataatgaaattgct
gaactctacgatgccatggtggctgctcagatcccctatgatgtgcagtactcagacatt
gattacatggagaggcagctagattttaccctcagtcccaagtttgctggctttcctgat
ctaatcagtcgaatgaagggtgctgggatgcgagtcatcctcattctggacccggctatt
tctggcaacgagaccaagccatatcctgccttcactcagggagtccagcaagatgtgttc
attaaatggcccgatgaagacagcatagtttggggaaaggtctggccagatttgcccaat
gtcactatcaatggatctcttgactgggacacccaagtagagttatacagagctcacgtt
gccttcccagactttttccgtaattcaacagtccagtggtggaagaaggaattgagagaa
ctgcacaacaattcccgggagccagagaagagcttgaagtttgatggaatgtggattgac
atgaatgaaccatcaagctttgtgaatggggcagttcctccaggctgcaggaatgacaca
ctcaatcatcctccttacatgcctcatctggagtcaagagacagagggctgagcagtaag
accctgtgcatggaaagtcagcagatcctgcctgatggaagtccagtgaggcactacgat
gtgcacaatctctatggctggtcccagacaaagcccacatatgaaggtgtgcaggaggct
acaggaaagcgaggaattgtgatcagtcgttcaacgtttccttcttcaggacgctgggca
ggacattggttgggagacaacacagcagcttgggatcagatgtataaatccatcattggt
atgatggagttcagtctttttggaatatcctatacaggagctgatatctgtgggttcttt
caagatgctgaatatgagatgtgtgctcgctggacacaactgggagccttttaccctttc
tctaggaaccacaataccattgggcctaggagacaagaccccgtatcttggaattccacc
tttgaagatctttcaagagatgtcctaaatataagatacactctgttgccttatctctac
accctgatgcataaggccaatgtagaaggcagcactgttgtccggcctctccttcatgaa
tttgttgaagacaaagaaacttgggacttattccgtcaattcttgtggggtccagccttc
ttaatcagccctgtcctggaacacaatgcccggaatgtgaatgcctacttccccaatgcc
cgctggtatgattactacacgggagaagatataggagtaaggaaacaatataaggaatta
tcagctcctcttgaccacattaatcttcatgtccgtgggggctacatccttccctggcaa
gaacctgccattaatacccggtacagccgagaaaaattcatgggtctcacagttgctttg
gatgatgaaggaaatgctaaaggttgtctcttctgggatgatggagaaagcatcaataca
tatgaaaatggagactattactttgcaaacttttctgctagaccgaacaatttggagcac
cacatcattcacaacaaatacatagtagctacaaaaccgttgtggctcggctttattcat
atatggggattaagcattgattctattaccaacgtcactgttgctcaaaaggaacatgtt
ttaaccatagacaattttcaacatgaccaagcaagacagatacttgcagtgaacttgact
gcacaccagataacattggggcatccctttgtggtgacatggtga

DBGET integrated database retrieval system