KEGG   Monodelphis domestica (opossum): 100009833Help
Entry
100009833         CDS       T01031                                 

Gene name
MGAM
Definition
maltase-glucoamylase (alpha-glucosidase)
Orthology
K12047  
maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100009833 (MGAM)
   00500 Starch and sucrose metabolism
    100009833 (MGAM)
 Organismal Systems
  Digestive system
   04973 Carbohydrate digestion and absorption
    100009833 (MGAM)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100009833 (MGAM)
    3.2.1.20  alpha-glucosidase
     100009833 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 3632 aa AA seqDB search
MGKKNFSKLEIILSFLLFILFIISVALIVILATNTSSVNDGSFVNTTSSPQTTIASSIVN
STTTSQTTTIAAECPAANQSERINCIPDQTPTQTTCSQRGCCWSPQGPENIPLCYFPKKY
GYQIRNSTYSRTGFTAHLNRLPTPSMFGNDIANVILTAEYQTANRFHFKISDPSEARYEV
PHEHVQLFPGNATSNLNYHVDCVEEPFSIKVTRKSNNRVLFDTGIGPLQFAQQYLQLSIQ
LPSANVYGLGEHVHQQYRHDMDWKTWPIFSRDTTPNEDMTNLYGAQTFFLCLEDTSGASF
GVFLMNSNAMEVTLQPAPAITYRVIGGVLDFYVFLGNTPEEVVREYLELIGRPFLPSYWS
LGFHLSRWVYGGLDGMKKVVERNRAAQLPCDVQYSDIDYMDEKKDFTYDKVLFNGLPEFV
EDLHNHGQKYVIIMDPAIFINSSNYGPYIRGSDMKIWVNASDGVTPLIGMVWPGQTVFPD
YTNPKCAQWWAEEFRLFYRELKFDGIWIDMNEPSNFENGSSIGCSHNTLNSPPFIPRILD
RYLPSKTLCMDAVQHWGKHYDVHSLYGYSMAIATEEAVKTVFPNKRSFIVTRSTFAGSGK
FAAHWLGDNAATWNDLRWSLPGMLEFNLFGIPMVGPDICGFTYNVSEELCRRWMQLGAFY
PFSRNHNGEGYKDQDPAAFGKDSLLLNSSRHYLNIRYTLLPYLYTLFFRAHTRGDTVARP
LLHEFYEDSNTWAVYRQFLWGPGLLITPVLDEGAKNVTAYLPDAVWYDYETGGQIPERKQ
QVEMLFSPEQIGLHLRGGYIFPIQQPAITTVASRKNPLGLIIAPDDNKEARGELFWDDGE
TKGTIASGSYILHEFLFTQNRLDMKVLHQSYNDPNNLAFEEIKILGTEEPTNITVKKNNV
PIASSPNVTYFEKDRVAMISGLELALGEEYTVEWSIKFREVIKIDCYPEDQAVSEENCTA
RGCAWELSNSPGVPNCYVINHLYSVSSIQYNPTGITADIFLNSPVRASNLLSAGLSTPVN
PLRLDVTYHKNDMLQFKIYAANSKRFEVPVPLNIPSSPSSTAENRLYEVLIKRDPFGIEI
RRRSTGTIIWDSQIPGFTFNDMFLRISTRLPSQYVYGFGETEHTTFRRNLTWHTWGMFSR
DQPPEYKKNSYGVHPYYMGLEDDGKAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYM
VLGPTPELVTQQYTELVGRPVMTPYWALGFQLCRYGYQNDAEIAELYDAMVAAQIPYDIQ
YSDIDYMERQLDFVLSSKFAGFPDLINRMKEAGMRVILILDPAISGNETQPYPPFLRGVE
DDVFIKWPDDNGIVWERWWPEVWPDLPNVTVNTSLDWDTQVELYRAHVAFPDFFRNSTVK
WWKRELLELYNNPQEPEKSLKYDGLWIDMNEPSSFVNGAVSPGCRNTTLNHPPYMPYLEA
RDRGLSSKTLCMESQQFLPDGSPVTHYDVHNLYGWSQTKPTYEGVQEATGKRGIVISRST
FPSSGRWAGHWLGDNKSTWDQLYKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWM
QLGAFYPFSRNHNALGTKRQDPVAWNSTFEDLSRSVLKTRYTLLPYLYTLMHKAHVEGST
VVRPLLHEFIEDKETWDIFLQFLWGPAFLVSPVLEPNSRQVSAYFPRARWYDYYSGSDIG
VRGQWKDLSAPLDHINLHIRGGYILPWQEPANNTHYSRRNSLGLLVALSDNGTAEGEFFW
DDGESIDTYEKGNYYFSTFSASEKHLDVKVFQQNYQDPNHLAFKEIKIFGLNFQPFLVTV
KENNIPIQSDAEIKYDPATKVTHITRLNLELGKEYTVEWSTKFRDTEKFDCYPDADGAQE
EKCKLRDCVWEPTNSTGVPFCYITKYYYTASNIQNTGVGLTADISRNAEVNHYPSTPINQ
LRLDVTFHKNHMLQFKIYDANNKRYEVPVPLNTPNSPTSQPENRLYEVTIKENPFGIEIR
RKSTGTVIWDSQVPGFTFNDMFLRISTRLPSHYIYGFGETEHTTFRRDLNWHTWGMFSRD
QPPGYKKNSYGVHPYYMGLEEDSNAHGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMV
LGPTPELVTQQYTELIGRPVMTPYWALGFQLCRYGYENDNEIAELYDAMVAAQIPYDVQY
SDIDYMERQLDFTLSPKFAGFPDLISRMKDAGMRVILILDPAISGNETKPYPAFTQGVQQ
DVFIKWPNEDSIVWGKVWPDLPNVTINGSLDWDTQVELYRAHVAFPDFFRNSTVQWWKQE
LRELHTNSREPEKSLKFDGMWIDMNEPSSFVNGAVPPGCRNDTLNHPPYMPHLESRDRGL
SSKTLCMESQQILPDGSPVRHYDVHNLYGWSQTKPTYEGVQEATGKRGIVISRSTFPSSG
RWAGHWLGDNTAAWDQMYKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWTQLGAF
YPFSRNHNTIGPRRQDPVSWNSTFEDLSRDVLNIRYTLLPYLYTLMHKANVEGSTVVRPL
LHEFVEDKETWDLFHQFLWGPAFLISPVLEHNARNVNAYFPNARWYDYYTGSDIGVRGQW
KDLSAPLDYINLHIRGGYILPWQEPANNTHYSRRNSLGLLVALSDNGTAEGEFFWDDGES
IDTYEKGNYYFSTFSASEKHLDVKVFQQNYQDPNNLAFKEIKIFGLNFQPLLVTVKENNI
PIQSDAEIKYNPATKVTHITRLNLELGKEYTVEWSTKFRDTEKFDCYPDADGAQEEKCKL
RDCVWEPTNSTGVPFCYITKYYYTASNIQNTGVGLTADISRNAEVNHYPSTPINQLRLDV
TFHKNHMLQFKIYDANNKRYEVPVPLNTPNSPTSQPENRLYEVAIKENPFGIEIRRKSTG
TVIWDSQVPGFTFNDMFLRISTRLPSHYIYGFGETEHTTFRRDLNWHTWGMFSRDQPPGY
KKNSYGVHPYYMGLEEDSNAHGVLLLNSNAMDVTFQPTPALTYRTIGGILDFYMVLGPTP
ELVTQQYTELIGRPVMTPYWALGFQLCRYGYENDNEIAELYDAMVAAQIPYDVQYSDIDY
MERQLDFTLSPKFAGFPDLISRMKGAGMRVILILDPAISGNETKPYPAFTQGVQQDVFIK
WPDEDSIVWGKVWPDLPNVTINGSLDWDTQVELYRAHVAFPDFFRNSTVQWWKKELRELH
NNSREPEKSLKFDGMWIDMNEPSSFVNGAVPPGCRNDTLNHPPYMPHLESRDRGLSSKTL
CMESQQILPDGSPVRHYDVHNLYGWSQTKPTYEGVQEATGKRGIVISRSTFPSSGRWAGH
WLGDNTAAWDQMYKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWTQLGAFYPFSR
NHNTIGPRRQDPVSWNSTFEDLSRDVLNIRYTLLPYLYTLMHKANVEGSTVVRPLLHEFV
EDKETWDLFRQFLWGPAFLISPVLEHNARNVNAYFPNARWYDYYTGEDIGVRKQYKELSA
PLDHINLHVRGGYILPWQEPAINTRYSREKFMGLTVALDDEGNAKGCLFWDDGESINTYE
NGDYYFANFSARPNNLEHHIIHNKYIVATKPLWLGFIHIWGLSIDSITNVTVAQKEHVLT
IDNFQHDQARQILAVNLTAHQITLGHPFVVTW
NT seq 10899 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaagaattttagcaagttggagataatcctctcttttctgctcttcatatta
ttcatcatctctgttgctctgattgtgattttagctacaaatacttcaagtgtgaatgat
ggctcatttgttaacactacttcaagtcctcagacaacaatagcctcttcaattgtgaat
tctactaccacctcccaaactaccacaattgcagcagaatgccctgcagcaaaccaatca
gaaaggatcaactgcatcccagatcaaacaccaacacagactacgtgttcccagcgtggc
tgctgctggagcccccaaggaccagaaaatatacccttgtgctacttccccaagaagtat
ggctatcagataagaaatagtacatactccaggacagggttcactgctcatttgaacaga
ttgcctaccccatcgatgtttggaaatgatattgccaatgtcatccttacagcagaatac
cagacagccaaccgtttccacttcaagatcagtgaccccagtgaagccagatatgaggta
cctcatgaacacgtccaactgtttcctggaaatgcaacttctaatttgaactatcatgtg
gattgtgttgaggagccatttagcatcaaagttacccggaaaagcaacaatcgtgtttta
tttgacactggtattggacccctccagtttgctcagcaatacttgcagctctctatccag
ttaccaagtgctaatgtgtatggcttaggggagcatgtacaccagcaatatcgtcatgac
atggactggaagacttggcccatcttctctcgggatactactcctaatgaagacatgact
aacttgtatggtgctcaaacatttttcttgtgccttgaagatacaagtggagcatccttt
ggggtttttctgatgaacagcaatgccatggaggttacccttcaacctgccccagcaatc
acttaccgagtcattgggggtgttctggatttttatgtcttcttagggaacactccagaa
gaggttgttcgggaatatttagagctcattggaaggccattcttgccatcttactggagt
cttggatttcatctcagtcgctgggtatatggaggtttggatgggatgaagaaagtcgta
gagagaaaccgagctgctcaacttccctgtgatgttcagtactctgatattgactacatg
gatgaaaagaaggacttcacttatgataaagtactatttaatggacttcctgagtttgtt
gaggatttacacaaccatggacagaaatatgtaattattatggatccagccattttcatt
aactcttccaactatggtccttacattcggggctcagacatgaagatatgggtcaatgca
tcagatggagtgacgccactaattgggatggtgtggccaggccagaccgtctttcctgac
tataccaatccgaagtgcgctcagtggtgggcagaggagttcagactcttctacagggag
ttaaagtttgatggaatctggattgatatgaatgaaccctccaactttgaaaatggttca
tctataggatgctcacataataccctgaactctcccccattcattcctagaatactggac
agatacctgccttccaagaccctttgcatggatgcagtacagcactggggcaaacattac
gatgtccacagtctgtatggctactcaatggccattgcaactgaagaagctgtaaaaact
gtcttccctaataaaagaagctttattgtgacacgctctacctttgctggatcgggcaaa
tttgcagcccattggctgggggacaacgcagccacttggaatgaccttcgttggtctcta
cctggcatgctcgaattcaacctgtttggtattcctatggttggccctgacatctgtggt
tttacctataatgtctcagaagaactatgcaggcggtggatgcagcttggggcattttat
ccattttccaggaatcacaacggtgaaggctacaaggaccaggatcctgctgcatttgga
aaagattcccttcttttgaattcctccagacactacctgaacatccgctatactctgctc
ccctatctctacaccctttttttccgagctcacactcggggggacactgtagcccggccc
cttcttcatgagttctatgaagatagtaacacctgggctgtgtatcggcagtttctgtgg
ggtcctgggcttctcattactcctgttctggatgagggtgctaagaatgtgacagcatac
ctgcctgatgctgtctggtatgactatgaaactggaggccaaataccagagagaaaacaa
caggtggaaatgctattctcaccagaacaaattggactccatcttcgaggtggctatatt
ttccccatccagcaaccagccataaccacagtagccagccgaaagaatcctcttggtctc
atcattgcccctgatgacaataaggaagctagaggagagcttttttgggatgatggggaa
actaaaggtacaatagctagtggttcctacatcttgcatgagtttttgttcacccaaaac
cgtttggatatgaaggttttgcatcaatcctacaatgatccaaataatttagcatttgaa
gagattaaaatcctcgggacagaagaacctaccaacatcactgtgaagaagaataatgtc
cccattgcatcttctcctaatgtcacttactttgaaaaggaccgggttgctatgatctca
ggacttgaacttgccctgggagaagaatacactgtggaatggagtataaaattcagagag
gtcatcaaaatagactgttatcctgaggaccaggcagtctctgaagaaaattgcacagcg
cgtggctgtgcctgggagttatctaattctccaggagtccctaactgctatgtcatcaat
cacctatattctgtcagtagcattcagtacaacccaacagggatcactgcagatatcttc
ttaaattcacctgtgcgtgcttccaacctgctctctgctgggctctctactcctgtgaac
cctctccgcttggatgtcacctaccataagaatgatatgctgcagtttaagatctatgct
gccaatagcaaaaggtttgaggtccccgtgcctctcaacatccccagctctccctctagc
accgctgagaatcggctttatgaagttctcataaagagggatccctttgggattgagatc
cgacgtcggagcacaggcacaataatttgggattcacagattcctggcttcacctttaat
gacatgttcctgcgaatctctacccgcctcccatcccagtatgtctatggctttggggag
acagaacacaccaccttccggagaaacttgacctggcatacgtggggaatgtttagtcga
gaccaacccccagaatacaagaagaattcctatggtgtacatccctattatatgggtctg
gaggatgatggcaaagcgcatggagtgctactactcaatagcaatgccatggatgtgact
tttcagcccactcctgcactgacatatcgcaccactgggggaattctggacttctatatg
gttttgggaccaaccccagaactcgtcactcagcagtacacagagttggttgggcggcca
gtgatgacaccttactgggccttagggttccagctttgtcgttatggataccaaaatgat
gctgaaattgctgaactttatgatgctatggtggcagcccagatcccttacgatatacag
tattcagacattgattacatggaacggcagttagacttcgtcctcagctccaagtttgct
ggctttcctgatctgatcaatcgaatgaaggaagctgggatgagagtcatcctgattctg
gacccggccatttctggcaatgagacccagccatatcctccattccttcggggggtcgag
gatgatgtgttcattaaatggccagatgacaatggaattgtttgggaaagatggtggcca
gaggtctggccagatttgcccaatgtcactgttaatacatctcttgattgggacactcaa
gtggagttatacagagctcatgttgccttcccagactttttccgtaattcaacagtcaag
tggtggaagcgggaattgctggaactctacaacaatccccaggagccagagaagagtctg
aagtatgatggactgtggattgacatgaatgaaccgtcaagctttgtgaatggagcagtt
tctccaggttgcaggaataccacactcaaccaccctccctatatgccctatttggaggca
agagatagaggtctgagcagcaaaaccctgtgcatggaaagtcagcaattcctgcctgat
ggaagtccagtgacacactatgatgtgcataatctctatggctggtcccagacgaagccg
acatatgaaggagttcaggaggctacaggaaagagaggaattgtgatcagtcgctcaact
ttcccttcttctggacgctgggcaggacactggctgggagacaacaaatcaacatgggac
caactctataagtccatcattggcatgatggagttcagtctctttggaatatcctataca
ggagctgatatttgtgggttctttcaagatgctgaatatgaaatgtgtgctcgatggatg
caactgggagccttttacccattctctaggaaccacaatgctcttgggaccaagaggcag
gacccagtggcttggaattctacctttgaggatctctcaagaagtgtccttaagacaaga
tataccctcttgccatatctctacaccctcatgcacaaggctcatgttgaaggcagcaca
gttgtccgaccccttctccatgagtttatagaagacaaagaaacctgggacattttcctt
cagttcttgtggggaccagccttcctagtcagtcctgtcctcgaacctaattccaggcaa
gtgtctgcctacttccccagagctcgttggtatgattactactcgggctcagatattgga
gtgaggggacagtggaaggatctgtcagctcctcttgaccacatcaatctccatattcgt
ggaggctacatccttccatggcaagaacctgctaataatactcattatagccggagaaac
tccttgggtcttcttgtggctttatcagataatggaacagctgaaggagagtttttctgg
gatgatggagagagtattgatacctatgaaaaggggaattactatttctcaacattctct
gccagtgagaaacacctggatgtgaaggtttttcagcagaattaccaagatccaaatcac
ctggcatttaaagagataaaaatctttggactgaatttccagccatttctagttactgtg
aaagagaataatattccaatccagtctgatgctgagataaagtatgatcctgcaacaaag
gtcactcacatcactagacttaaccttgagctggggaaagagtatacagtggagtggtcc
acaaagttcagagacacagaaaaatttgactgctacccagatgcagatggtgctcaggaa
gagaaatgtaaattacgtgactgtgtctgggagccaaccaattctacaggagtccccttt
tgctacatcactaagtattattatactgccagtaacattcagaatacaggagtgggccta
acagcagacatctcccgaaatgcagaagtcaatcactatccttccacacccattaaccag
ctccgattggatgtgacattccataaaaatcacatgctacagtttaagatctatgatgcc
aacaacaagagatatgaagtcccagtgcccttaaatactccaaactcccccaccagtcaa
cctgaaaatcgtctctatgaggtgaccatcaaggaaaacccatttggaattgagatccgc
cgaaaaagcacgggcactgtgatctgggattcccaggtccctggctttacctttaatgat
atgttcctacgaatctccacccgcctcccatcacactacatctatggctttggagaaaca
gagcacacgaccttcaggagggatctaaactggcacacttggggaatgttttctcgagac
cagcctccaggctacaagaagaattcctatggtgtacacccatattacatgggtctggaa
gaggacagcaatgcccatggagtgctcctgctcaacagcaatgccatggatgtaactttc
caaccaacccctgcactcacatatcggaccatcggaggtattctggacttttacatggtt
ttgggacctaccccagagctcgttactcagcagtacacagagttgattggccggccagtg
atgactccttactgggccttaggattccagctgtgtcgttatggatacgagaatgataat
gaaattgccgaactctacgatgccatggtggctgctcagatcccctatgatgtgcagtac
tcagacattgattacatggagaggcagctagattttaccctcagtcccaagtttgctggc
tttcctgatctaatcagtcgaatgaaggatgctgggatgcgagtcatcctcattctggac
ccggctatttctggcaacgagaccaagccatatcctgccttcactcagggagtccagcaa
gatgtgttcattaaatggcctaatgaagacagcatagtttggggaaaggtctggccagat
ttgcccaatgtcactatcaatggatctcttgactgggacacccaagtagagttatacaga
gctcacgttgccttcccagactttttccgtaattcaacagtccagtggtggaagcaggaa
ttgagggaactgcacaccaattcccgggagccagagaagagcttgaagtttgatggaatg
tggattgacatgaatgaaccatcaagctttgtgaatggggcagttcctccaggctgcagg
aatgacacactcaatcatcctccttacatgccccatctggagtcaagagacagagggctg
agcagtaagaccctgtgcatggaaagtcagcagatcctgcctgatggaagtccagtgagg
cactacgatgtgcacaatctctatggctggtcccagacaaagcccacatatgaaggtgtg
caggaggctacaggaaagcgaggaattgtgatcagtcgttcaacatttccttcttcagga
cgctgggcaggacattggttgggagacaacacagcagcctgggatcagatgtataaatcc
atcattggtatgatggagttcagtctttttggaatatcctatacaggagctgatatctgt
gggttctttcaagatgctgaatatgagatgtgtgctcgctggacacaactgggagccttt
taccctttctctaggaaccacaataccattgggcctaggagacaagaccccgtatcttgg
aattccacctttgaagatctttcaagagatgtcctaaatataagatacactctgttgcct
tatctctacactctgatgcataaggccaacgtagaaggcagcactgttgtccggcccctc
cttcatgaatttgttgaagacaaagaaacttgggacttattccatcaattcttgtggggt
ccagccttcttaatcagccctgtcctggaacacaatgcccggaatgtgaatgcctacttc
cccaatgcccgctggtatgattactacacgggctcagatattggagtgaggggacagtgg
aaggatctgtcagctcctcttgactacatcaatctccatattcgtggaggctacatcctt
ccatggcaagaacctgctaataatactcattatagccggagaaactccttgggtcttctt
gtggctttatcggataatggaacagctgaaggagagtttttctgggatgatggagagagc
attgatacctatgaaaaggggaattactatttctcaacattctctgccagtgagaaacac
ctggatgtgaaggtttttcagcagaattaccaagatccaaataacctggcatttaaagag
atcaaaatctttggactgaatttccagccacttctagttactgtgaaagagaataatatt
ccaatccagtctgatgctgagataaagtataatcctgcaacaaaggtcactcacatcact
agacttaaccttgagctggggaaagagtatacagtggagtggtccacaaagttcagagac
acagaaaaatttgactgctacccagatgcagatggtgcccaggaagagaaatgtaaatta
cgtgactgtgtctgggagccaaccaattctacaggagtccccttttgctacatcactaag
tattattatactgccagtaacattcagaatacaggagtgggcctaacagcagacatctcc
cgaaatgcagaagtcaatcactatccttccacacccattaaccagctccgattggatgtg
acattccataaaaatcacatgctacagtttaagatctatgatgccaacaacaagagatat
gaagtcccagtgcccttaaatactccaaactcccccaccagtcaacctgaaaatcgtctc
tatgaggtggccatcaaggaaaacccatttggaattgagatccgccgaaaaagcacgggc
actgtgatctgggattcccaggtccctggctttacctttaatgatatgttcctacgaatc
tccacccgcctcccatcacactacatctatggctttggagaaacagagcacacgaccttc
aggagggatctaaactggcacacttggggaatgttttctcgagaccagcctccaggctac
aagaagaattcctatggtgtacacccatattacatgggtctggaagaggacagcaatgcc
catggagtgctcctgctcaacagcaatgccatggatgtaactttccaaccaacccctgca
ctcacatatcggaccatcggaggtattctggacttttacatggttttgggacctacccca
gagctcgttactcagcagtacacagagttgattggccggccagtgatgactccttactgg
gccttaggattccagctgtgtcgttatggatacgagaatgataatgaaattgctgaactc
tacgatgccatggtggctgctcagatcccctatgatgtgcagtactcagacattgattac
atggagaggcagctagattttaccctcagtcccaagtttgctggctttcctgatctaatc
agtcgaatgaagggtgctgggatgcgagtcatcctcattctggacccggctatttctggc
aacgagaccaagccatatcctgccttcactcagggagtccagcaagatgtgttcattaaa
tggcccgatgaagacagcatagtttggggaaaggtctggccagatttgcccaatgtcact
atcaatggatctcttgactgggacacccaagtagagttatacagagctcacgttgccttc
ccagactttttccgtaattcaacagtccagtggtggaagaaggaattgagagaactgcac
aacaattcccgggagccagagaagagcttgaagtttgatggaatgtggattgacatgaat
gaaccatcaagctttgtgaatggggcagttcctccaggctgcaggaatgacacactcaat
catcctccttacatgcctcatctggagtcaagagacagagggctgagcagtaagaccctg
tgcatggaaagtcagcagatcctgcctgatggaagtccagtgaggcactacgatgtgcac
aatctctatggctggtcccagacaaagcccacatatgaaggtgtgcaggaggctacagga
aagcgaggaattgtgatcagtcgttcaacgtttccttcttcaggacgctgggcaggacat
tggttgggagacaacacagcagcttgggatcagatgtataaatccatcattggtatgatg
gagttcagtctttttggaatatcctatacaggagctgatatctgtgggttctttcaagat
gctgaatatgagatgtgtgctcgctggacacaactgggagccttttaccctttctctagg
aaccacaataccattgggcctaggagacaagaccccgtatcttggaattccacctttgaa
gatctttcaagagatgtcctaaatataagatacactctgttgccttatctctacaccctg
atgcataaggccaatgtagaaggcagcactgttgtccggcctctccttcatgaatttgtt
gaagacaaagaaacttgggacttattccgtcaattcttgtggggtccagccttcttaatc
agccctgtcctggaacacaatgcccggaatgtgaatgcctacttccccaatgcccgctgg
tatgattactacacgggagaagatataggagtaaggaaacaatataaggaattatcagct
cctcttgaccacattaatcttcatgtccgtgggggctacatccttccctggcaagaacct
gccattaatacccggtacagccgagaaaaattcatgggtctcacagttgctttggatgat
gaaggaaatgctaaaggttgtctcttctgggatgatggagaaagcatcaatacatatgaa
aatggagactattactttgcaaacttttctgctagaccgaacaatttggagcaccacatc
attcacaacaaatacatagtagctacaaaaccgttgtggctcggctttattcatatatgg
ggattaagcattgattctattaccaacgtcactgttgctcaaaaggaacatgttttaacc
atagacaattttcaacatgaccaagcaagacagatacttgcagtgaacttgactgcacac
cagataacattggggcatccctttgtggtgacatggtga

DBGET integrated database retrieval system