KEGG   Monodelphis domestica (opossum): 100009879Help
Entry
100009879         CDS       T01031                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00562  Inositol phosphate metabolism
mdo04022  cGMP-PKG signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04371  Apelin signaling pathway
mdo04611  Platelet activation
mdo04725  Cholinergic synapse
mdo04921  Oxytocin signaling pathway
mdo05145  Toxoplasmosis
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100009879 (PIK3CG)
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100009879 (PIK3CG)
   04072 Phospholipase D signaling pathway
    100009879 (PIK3CG)
   04022 cGMP - PKG signaling pathway
    100009879 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    100009879 (PIK3CG)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100009879 (PIK3CG)
  Endocrine system
   04921 Oxytocin signaling pathway
    100009879 (PIK3CG)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100009879 (PIK3CG)
  Nervous system
   04725 Cholinergic synapse
    100009879 (PIK3CG)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100009879 (PIK3CG)
   05145 Toxoplasmosis
    100009879 (PIK3CG)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100009879 (PIK3CG)
Membrane trafficking [BR:mdo04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100009879 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 PARP_regulatory Myc-LZ
Motif
Other DBs
NCBI-GeneID: 100009879
NCBI-ProteinID: XP_001362146
Ensembl: ENSMODG00000016386
UniProt: F7E9G2
Position
8
AA seq 1099 aa AA seqDB search
MDLEDHEPVVLREDHRGRRRRMKPQSAGISSSSMERIPIEFILPTSHQNTKATETVILEA
AGNCNVEQVKAQVWMQAMETSTTMQFYHQSSPEQFLLLYQKKGQWYEIYDKYQLIQTLDC
VKYWKALQKNMGQIHVVQRQPPTEETREFQQQLNDLIGYDVTNMSNVHDDELEFTRRRLV
TPRMMEVARRDPKLYAMHPWVTSKPLPTYLLKKIVNNCIFIVIHRSTTSQTIKVSADDTP
GTILQSFFTKMAKKKSLMDIPESQSELDFVLRVCGRDEYIVGETPIKNFQWIRHCLKNGE
EIHLVLDAPPDPGQDEVRKEEWPLVDDCTGVTGYHEQLTINGKNHERVFTLSLWDCDQRF
RVKIRGIDIPVLPRNTELTVFVEANIQHGQQVLCQRRTTSKPFTEEVLWNVWLEFGIKIK
DLPKGAILNLQIYCGKATAQSSKAEISSFETKGKTQLLYYVNLLLIDHRFLLRHGEYVLH
MWKISGKGEDQGSINADKLTSATNPDTENSMSISILLDNYCHPIALPKHRPTPDPEGDRV
RGEMPNQLRKQLEEIIATDPLNPLTAKDKELLWHFRYESLKHPKAYPKLFSSVKWGQQEI
VAKTYQLLARREAWDQSDLDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHYLLQL
VQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVILEAYLRG
CGMAMLEDFTKQVQVIRMLQKVTIDIKSLSAEKYDVTSQVIAQLKQKLENLQNSNLPKNF
RVPYDPGLRAGTLVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLRQDML
ILQILRIMGSIWEAESLDLCLQPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFK
DEVLNHWLKEKCPIEEKFQAAVEKFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHI
DFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKSSLHFQKFQDICVKAYLALRQH
TNLLIILFSMMLMTGMPQLTSKEDIEYIRDTLTVGKNEEDAKKYFLDQIEVCRDKGWTVQ
FNWFLHLVLGIKQGEKHSA
NT seq 3300 nt NT seq  +upstreamnt  +downstreamnt
atggatttggaggaccatgagcccgtggttctgagagaagaccacaggggaaggaggcgg
agaatgaagccacaaagtgctggcatcagctcatcttcaatggagcgcattcccatagaa
tttatcctgcccaccagccaccagaacaccaaagccaccgaaacagtgatcctagaagca
gctggaaattgtaatgtggaacaggtgaaagcacaggtgtggatgcaggccatggagact
agcacaaccatgcagttctatcaccagtcctccccagagcaatttctcctgctgtaccag
aaaaagggacagtggtatgagatctatgacaagtaccaattgatacagacattggactgt
gtgaagtactggaaagctctccagaagaacatgggccagatccatgtagtccagaggcag
ccacccacagaggaaactcgggagttccaacagcagctaaatgacctgattggctatgac
gttactaacatgagcaacgtccatgacgatgagctagaattcacccggcgccggcttgtc
actccacggatgatggaggtcgcaagacgagaccccaaactctatgccatgcatccttgg
gtgacttccaaaccactccccacatacctactgaaaaagattgtcaacaattgcattttc
atcgtcatccaccgaagtaccacaagccagaccatcaaggtctctgcagatgatacccca
ggcacgatcttacagagcttcttcaccaagatggctaagaagaagtcactaatggacatc
cctgagagtcagagtgagctggactttgtgcttcgggtctgtggccgggatgagtatatc
gtgggtgagacaccgatcaagaatttccagtggattaggcactgtctcaagaatggcgaa
gagattcaccttgtgctagatgctcctcctgacccaggacaggatgaggtgaggaaggag
gagtggccactcgtagatgactgcacaggagtcacaggctaccatgagcagctgacaata
aatgggaagaatcatgagagagtgttcactctttccctgtgggactgtgaccaaaggttc
agggtgaagatcaggggcattgacatccctgtgctcccacggaacactgagctcacagtc
tttgtggaagcaaacatccagcatggacagcaggtcctttgtcaaagacgaaccacctct
aaacctttcacagaggaggtgctctggaatgtgtggcttgagtttggtatcaaaatcaag
gacttgcccaaaggggctatactgaaccttcagatttactgtgggaaagcaacagctcag
tcttccaaagctgagatttctagcttcgagaccaaaggcaaaactcagctcctctattat
gtgaacctactgctgattgaccaccgatttctcctgaggcacggagaatatgtcctgcac
atgtggaagatatcagggaaaggagaggaccaagggagcatcaatgcagacaagcttaca
tcagcaaccaacccagatacggagaattccatgtcaatctccatccttctggacaattat
tgtcacccaatagccttgcccaagcacaggcccacgcctgaccctgaaggggacagggtt
aggggagaaatgcccaatcagctacgtaaacagctggaagagatcatagccactgaccca
cttaacccactcacagcaaaggacaaggaattactatggcattttaggtatgaaagcctg
aagcaccccaaagcatatcctaaactgtttagctcagtgaaatggggacagcaagaaatt
gtggccaaaacataccagttgttagccagaagagaagcttgggaccaaagcgatttggat
gttgggttaacaatgcaactcttagactgcaacttttcagatgaaaatgtaagagctatt
gcagtgcaaaagctagaaagcttggaggatgatgatgtcttgcattacctgctgcaacta
gttcaggctgtgaaatttgaaccttaccatgacagtgctcttgccagatttctgctgaaa
cgtggtttgagaaacaagagaattggtcacttcttgttctggtttctgagaagtgagatt
gctcagtccagacactaccaacaacggtttgcagtgatccttgaagcctatctgaggggc
tgtggcatggctatgttagaggatttcacaaaacaggttcaagtcatcaggatgctacaa
aaagtcactattgatattaagtcactttctgcagaaaagtatgatgtcacctcccaagtt
atcgcacaacttaagcaaaagcttgaaaaccttcagaattctaatcttccaaaaaatttt
agagttccctatgatcccggcctgagagcaggaacactcgtgattgaaaaatgtaaagta
atggcatccaaaaagaagcccttatggcttgaatttaaatgtgctgatcccacagccctg
tccaatgaaaccataggaattatcttcaaacacggggatgatttgcgtcaagacatgctc
attttgcaaattcttcgaattatgggatctatttgggaagcagagtcattggacttgtgc
ctgcagccatatggttgcatttcaactggagacaaaataggaatgattgaaattgtgaag
gatgctacaacgattgccaaaattcagcagagcacagtgggtaatactggagcatttaag
gatgaagtgctaaatcattggctcaaagaaaaatgcccaattgaagaaaagttccaggca
gcagtggagaaatttgtatattcatgtgctggctactgtgtggcaacctttgttcttggt
attggagacagacacaatgacaacattatgatcacagaaacaggaaatctgtttcatatt
gactttggccacattcttgggaattataaaagtttcctgggcatcaacaaagagagagtt
ccatttgtgctaactcctgacttcctcttcgtgatgggaacttctggaaagaaaagcagc
ctacacttccagaaatttcaggacatttgtgtcaaggcttacttagctcttcggcaacac
actaacctgctgattatcctgttttccatgatgctgatgactggaatgccccagttaact
agcaaggaagatattgaatatatccgggataccctgacagtggggaaaaatgaagaggac
gccaaaaagtatttccttgatcagatagaagtttgtagagacaaaggctggactgtgcag
tttaattggttcttacatcttgttcttggaatcaaacaaggagaaaaacattctgcctaa

DBGET integrated database retrieval system