KEGG   Monodelphis domestica (opossum): 100009969Help
Entry
100009969         CDS       T01031                                 

Gene name
LYPLA2
Definition
(RefSeq) lysophospholipase II
  KO
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100009969 (LYPLA2)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100009969 (LYPLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
4
AA seq 164 aa AA seqDB search
MKMVMPSWFDLMGLSPDAPEDEAGIKKAAESIKALIEHEVKNGIPANRIILGGFSQGGAL
SLYTALTCPHPLAGIVALSCWLPLHRAFPQAANGMARDMAILQCHGELDPMVPVRFGALT
SEKLKSVVPPAKVQFKTYPGVMHSSCPQEMAAVKEFIEKLLPPI
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaagatggtgatgccttcctggtttgacctgatgggtctgagtcctgatgccccggaa
gacgaagctggaatcaagaaggctgcagagagcatcaaggccctgattgagcacgaggtg
aagaatggaattccagctaatcgaatcatcttggggggcttctcccagggtggagcccta
tccctctacacagctcttacctgcccgcaccccctggctggcatcgtggcactcagctgc
tggctgcctctgcatcgggccttccctcaggcggccaacggcatggcccgggacatggcc
atcctgcagtgccacggggagctggaccccatggtgcccgtgcgcttcggagccctcacc
tcagagaaactcaagtccgttgtccctccagccaaggtccagttcaagacttaccctggt
gtcatgcacagctcctgtccccaggagatggcagctgtgaaggagttcattgagaagctg
ctgccccccatctaa

DBGET integrated database retrieval system