KEGG   Monodelphis domestica (opossum): 100010271Help
Entry
100010271         CDS       T01031                                 

Gene name
PDK3
Definition
pyruvate dehydrogenase kinase, isozyme 3
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100010271 (PDK3)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100010271 (PDK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 415 aa AA seqDB search
MRLYRWLLKQPVPKQIEQYSRFSPSPLSIKQFLDFGRDNACEKTSYMFLRKELPVRLANT
MREVNLLPDNLLSRPSVGLVQSWYMQSFLEFLEYENKSPEDQQVLDDFLQDLIKVRNRHN
DVVPTMAQGVIEYKEKYGFDPFISSNIQYFLDRFYTNRISFRMLINQHTLLFGDDTNPSH
PKHIGSIDPNCNVAEVVKDAYETAKMLCEQYYMVAPELEVEEFHAKAPDKPIQVVYVPSH
LFHMLFELFKNSMRATVELYENRKEGYPSIKTLVTLGKEDLSIKISDHGGGVPLRKIDRL
FNYMYSTAPRPSLEPSRAAPLAGFGYGLPISRLYARYFQGDLKLYSMEGVGTDAVIYLKA
LSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPKDASKYRAKLDKIKTNRTF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcggctttaccggtggctgctgaagcagcccgtcccaaagcagatcgagcaatactcc
cgcttctccccatcgccgctctctattaaacagttcttggactttggacgtgacaatgca
tgtgagaagacatcatatatgttcttacgaaaagagcttccagtgcgactggctaacacg
atgagagaagtcaatctattgcctgataacttgctgagccgtccatcggtagggctggtg
cagagttggtacatgcaaagctttcttgaatttttagagtatgaaaataagagtcctgaa
gaccaacaagtgttggatgactttttacaagacctcattaaagtcagaaatagacacaat
gatgtggttcctaccatggcacaaggggtgattgaatacaaggagaagtatggttttgat
cctttcattagcagtaacatccagtattttctggatcggttttataccaaccgcatctct
tttcgcatgcttattaaccagcacacactcctttttggtgatgacactaatcctagtcat
cctaaacacattggaagtattgatcccaactgtaacgtggctgaagtagtgaaagatgcc
tatgaaacagctaagatgctttgtgaacaatattatatggtagccccagaattggaagtt
gaagaattccatgcgaaagctccagacaaaccaattcaggtagtttatgtgccctcacat
ctgtttcacatgctgtttgagttgtttaagaactcaatgagagcaacagtagaactttat
gaaaacagaaaagaaggttacccatctattaaaactctagtaacattgggcaaagaagat
ttatccattaagataagtgaccatggtggtggtgttccactgcgaaaaatagatcgtcta
tttaactatatgtattcaactgctcccagacctagcctggaaccatcaagagcagcacct
ttggctggatttggctatgggttgcccatttcccgcctttatgctagatactttcaaggt
gacctaaaactctattcaatggaaggagtgggcactgatgctgtaatttatttgaaggct
ctttcaagtgaatcatttgaaaggcttccagtgtttaataagtcagcatggaggcattac
aagactacccctgaagctgatgactggagcaatcctagcagtgaacccaaggatgcttca
aaatacagggccaaacttgacaagatcaagacaaatagaactttctaa

DBGET integrated database retrieval system