KEGG   Monodelphis domestica (opossum): 100010279Help
Entry
100010279         CDS       T01031                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo01522  Endocrine resistance
mdo04010  MAPK signaling pathway
mdo04015  Rap1 signaling pathway
mdo04068  FoxO signaling pathway
mdo04071  Sphingolipid signaling pathway
mdo04114  Oocyte meiosis
mdo04218  Cellular senescence
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04370  VEGF signaling pathway
mdo04380  Osteoclast differentiation
mdo04550  Signaling pathways regulating pluripotency of stem cells
mdo04611  Platelet activation
mdo04620  Toll-like receptor signaling pathway
mdo04621  NOD-like receptor signaling pathway
mdo04622  RIG-I-like receptor signaling pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04657  IL-17 signaling pathway
mdo04658  Th1 and Th2 cell differentiation
mdo04659  Th17 cell differentiation
mdo04660  T cell receptor signaling pathway
mdo04664  Fc epsilon RI signaling pathway
mdo04668  TNF signaling pathway
mdo04670  Leukocyte transendothelial migration
mdo04714  Thermogenesis
mdo04722  Neurotrophin signaling pathway
mdo04723  Retrograde endocannabinoid signaling
mdo04728  Dopaminergic synapse
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04912  GnRH signaling pathway
mdo04914  Progesterone-mediated oocyte maturation
mdo04917  Prolactin signaling pathway
mdo04926  Relaxin signaling pathway
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo05014  Amyotrophic lateral sclerosis (ALS)
mdo05132  Salmonella infection
mdo05133  Pertussis
mdo05140  Leishmaniasis
mdo05142  Chagas disease (American trypanosomiasis)
mdo05145  Toxoplasmosis
mdo05152  Tuberculosis
mdo05160  Hepatitis C
mdo05164  Influenza A
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
mdo05169  Epstein-Barr virus infection
mdo05205  Proteoglycans in cancer
mdo05418  Fluid shear stress and atherosclerosis
Module
mdo_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100010279 (MAPK12)
   04010 MAPK signaling pathway
    100010279 (MAPK12)
   04370 VEGF signaling pathway
    100010279 (MAPK12)
   04668 TNF signaling pathway
    100010279 (MAPK12)
   04068 FoxO signaling pathway
    100010279 (MAPK12)
   04071 Sphingolipid signaling pathway
    100010279 (MAPK12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    100010279 (MAPK12)
   04218 Cellular senescence
    100010279 (MAPK12)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100010279 (MAPK12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100010279 (MAPK12)
   04620 Toll-like receptor signaling pathway
    100010279 (MAPK12)
   04621 NOD-like receptor signaling pathway
    100010279 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    100010279 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    100010279 (MAPK12)
   04660 T cell receptor signaling pathway
    100010279 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    100010279 (MAPK12)
   04659 Th17 cell differentiation
    100010279 (MAPK12)
   04657 IL-17 signaling pathway
    100010279 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    100010279 (MAPK12)
   04670 Leukocyte transendothelial migration
    100010279 (MAPK12)
  Endocrine system
   04912 GnRH signaling pathway
    100010279 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    100010279 (MAPK12)
   04917 Prolactin signaling pathway
    100010279 (MAPK12)
   04926 Relaxin signaling pathway
    100010279 (MAPK12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100010279 (MAPK12)
  Nervous system
   04728 Dopaminergic synapse
    100010279 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    100010279 (MAPK12)
   04722 Neurotrophin signaling pathway
    100010279 (MAPK12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100010279 (MAPK12)
  Development
   04380 Osteoclast differentiation
    100010279 (MAPK12)
  Environmental adaptation
   04714 Thermogenesis
    100010279 (MAPK12)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    100010279 (MAPK12)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100010279 (MAPK12)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100010279 (MAPK12)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100010279 (MAPK12)
  Infectious diseases
   05132 Salmonella infection
    100010279 (MAPK12)
   05133 Pertussis
    100010279 (MAPK12)
   05152 Tuberculosis
    100010279 (MAPK12)
   05164 Influenza A
    100010279 (MAPK12)
   05160 Hepatitis C
    100010279 (MAPK12)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100010279 (MAPK12)
   05169 Epstein-Barr virus infection
    100010279 (MAPK12)
   05145 Toxoplasmosis
    100010279 (MAPK12)
   05140 Leishmaniasis
    100010279 (MAPK12)
   05142 Chagas disease (American trypanosomiasis)
    100010279 (MAPK12)
  Drug resistance
   01522 Endocrine resistance
    100010279 (MAPK12)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100010279 (MAPK12)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100010279 (MAPK12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Haspin_kinase Kinase-like UvrD_C
Motif
Other DBs
NCBI-GeneID: 100010279
NCBI-ProteinID: XP_001362221
Position
8
AA seq 364 aa AA seqDB search
MSSPPPPRKGFYRQEVTKTAWEVRELYRDLQPVGSGAYGAVCSAIDSRTGTKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDDTLDDFTDFYLVMPFMGTDLSKLM
KHEQLSDDRIQFLVYQILRGLKYIHAAGIVHRDLKPGNLAVNEDCELKILDFGLARQTDS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGSDHLDQLMEIMK
VTGTPPPEFVQRLQSQDAKNYMENLPELEKKDFASILKNATPLAVNLLEKMLVLDAEKRV
TAAEALTHPYFETVHESEEEPQAQLYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRLLDAK
ETSL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagttcccctccgcccccccggaagggcttttaccggcaggaggtcactaagacagct
tgggaggtgcgggaactctaccgcgacctgcagcccgtgggctctggggcttacggggcc
gtgtgctcggccattgacagcaggaccggcaccaaggtggccatcaagaaactgtaccgt
cccttccagtcggagctgttcgccaagcgcgcctaccgggagctgcggctactcaaacac
atgcgccatgagaatgtgattggcttactggatgtcttcaccccggatgacacgctggat
gacttcacagacttttacctggtcatgccattcatgggcacggatctcagcaagctgatg
aaacatgagcagctcagcgacgaccggatccagttcttggtttaccagattcttcggggg
ctcaagtacatccatgctgctggcatcgtccacagggatctcaagcctggtaacctggca
gtgaatgaggactgtgagctgaagattctggactttggcctggccagacagacagacagt
gagatgactggctacgtggtgaccagatggtaccgggcacctgaggtcatcctcaactgg
atgcgttacacccagacagtggatatctggtctgtgggctgcatcatggcagagatgatc
accgggaagatccttttcaaagggagtgaccacctggaccagctgatggagatcatgaag
gtgaccgggacacctccccctgagttcgtgcagcgccttcagagtcaggatgccaagaac
tacatggagaatctcccggagctggagaagaaggactttgcctccatcctgaagaacgcg
acccccctggctgtgaacctgctcgagaagatgttggtactggatgccgagaagcgagtg
acagccgcagaggcgctgactcacccatactttgagaccgtgcatgaatctgaggaggag
ccccaggcccagctctatgatgactcctttgatgacgttgaccggacattggaggagtgg
aaacgagtcacatacaaagaagtcctcagctttaagccccctcggcttctggatgcaaag
gaaacatctctgtga

DBGET integrated database retrieval system