KEGG   Monodelphis domestica (opossum): 100010623Help
Entry
100010623         CDS       T01031                                 

Gene name
ALAD
Definition
aminolevulinate dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    100010623 (ALAD)
Enzymes [BR:mdo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     100010623 (ALAD)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100010623 (ALAD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 330 aa AA seqDB search
MQPQSVLHSGYFHPLLRNWQAAASTFDASNLIYPIFVTDIPDAVQPIDSLPGIARYGVNK
LEEMLQPLVAKGLKCVLIFGVPSKVTKDERGSGADTEDTPAIQAIHLLRKAFPSLLVACD
VCLCPYTSHGHCGLLREDGSFLAEESSRRLAEVALAYAKAGCQVVAPSDMMDGRIGAIKE
ALITHGLGNKVSVMSYSAKFASCFYGPFRDAAHSSPAFGDRRCYQLPPGARGLALRAVDR
DVQEGADILMVKPGLPYLDIVREVKNKHSVLPLAVYHVSGEFAMLWHGARAGALDLKTAV
MEAMTAFRRAGADIIITYYTPQLLQWLKEP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcagccccagtctgtgcttcacagtggctacttccacccattgttgcgaaactggcaa
gcagcagcgagcaccttcgatgcctccaatctcatctaccccatctttgtcacggatatt
cctgatgctgtgcaaccaatcgacagccttcctggcattgccaggtatggtgtgaataag
ctggaagagatgcttcagcccttggtagccaaaggcctaaagtgtgtcctgatctttggg
gtgcccagcaaggtcacaaaggatgagcggggctcaggagctgacacagaagacacccca
gccattcaagcaattcatctgctgcggaaagcttttcccagtctcctggtagcctgtgat
gtgtgtctgtgtccgtatacctcccacggtcactgtgggctcctgagagaagatggctca
ttcctggctgaggaaagcagcaggaggttggcagaagttgctctagcctacgccaaggca
ggctgtcaggtggtggctccatcagacatgatggatgggcgaattggtgccatcaaagaa
gcattaatcactcacgggcttggcaacaaggtatcagtgatgagctacagtgccaagttt
gcttcttgtttctacggtcctttccgggatgcagcacattctagcccagctttcggggac
cgacgatgctaccaattgcctcctggggctcggggcctggcccttcgagctgtggatcga
gatgtccaagaaggggcagatatcctgatggtcaagccagggttaccgtacttggacatt
gtgagagaagtgaagaacaagcactctgtcctgccccttgctgtgtatcacgtttctgga
gagtttgccatgctgtggcatggtgcccgagccggggcccttgatctgaagactgctgtt
atggaggccatgacagccttccggagagcaggtgccgacatcatcatcacctactataca
cctcagctcctacagtggctaaaggagccatga

DBGET integrated database retrieval system