KEGG   Monodelphis domestica (opossum): 100010713Help
Entry
100010713         CDS       T01031                                 

Gene name
CLTC
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100010713 (CLTC)
   04142 Lysosome
    100010713 (CLTC)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    100010713 (CLTC)
  Nervous system
   04721 Synaptic vesicle cycle
    100010713 (CLTC)
 Human Diseases
  Neurodegenerative diseases
   05016 Huntington's disease
    100010713 (CLTC)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100010713 (CLTC)
Exosome [BR:mdo04147]
 Exosomal proteins
  Proteins found in most exosomes
   100010713 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1675 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVA
LVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGN
QPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISG
ETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGA
EELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGI
LLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYL
RANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDE
EPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSV
EDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVN
FSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQF
STDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYY
DSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVL
LESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTS
AVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEV
VQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQ
VGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFAC
VDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTEL
AILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMN
HPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFS
KVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLE
KHELIEFRRIAAYLFKGNNRWKQSVELCKKDRLYKDAMQYASESKDTELAEELLQWFLQE
EKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLSKVDKLDASESLR
KEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5028 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatcctgcctatccgtttccaggagcatctccagctccagaatctgggtatc
aacccagcaaatattggcttcagtactttgactatggagtcggacaaattcatctgcatt
agagaaaaagtaggagagcaagcccaggtggtaatcattgatatgaatgatccaagtaat
cccattcgtcgaccaatttcagctgacagcgccatcatgaatccagctagcaaagtgatt
gcattaaaagctgggaaaacacttcagatatttaacattgaaatgaaaagtaaaatgaag
gctcacaccatgactgatgatgtcaccttttggaaatggatctctttgaacactgttgcc
cttgttacggacaatgcagtctatcattggagtatggaaggagagtcacaaccagtgaag
atgtttgatcgccattctagtcttgctggttgccagattatcaactatcgtacagatgca
aagcagaagtggttacttcttactggcatatctgcacagcaaaatcgtgtggtgggagcc
atgcaactttattctgtagacagaaaagtgtctcagcccattgaaggacatgctgctagc
tttgcacaatttaagatggaaggaaatgctgaagagtcaacactgttttgctttgcagta
agggggcaagctggaggcaagttacatatcattgaagttggcacaccacctacagggaat
cagccttttccaaagaaagcagtagatgtcttctttcctccagaagcacaaaatgatttt
cctgtggcaatgcagatcagtgaaaaacacgatgtggtgttcttgattaccaaatatgga
tatatccatttatatgacctggagactggcacctgcatctacatgaatagaatcagtgga
gaaaccatctttgttactgcacctcatgaagcaacagctggaattattggtgtaaacaga
aagggacaagtgctgtcagtgtgtgtggaagaagagaatataattccttacatcaccaac
gtcctacagaatcctgatctggctttgagaatggctgtgcgtaacaacttagctggagct
gaagagctttttgcccggaaatttaatgctctctttgcccaaggaaattactcagaggca
gcaaaagtggctgctaatgcaccaaagggaattttacgtactccagacaccatccgtcgg
ttccagagtgttccagcacaaccgggccagacgtcacctctacttcagtactttggaatc
cttttagaccaaggccaactaaataaatatgaatccttagaactgtgtaggcctgtgctt
caacagggacgtaaacagctgttagagaaatggttaaaagaagataagttggagtgttca
gaagaattgggtgatctagtaaagtctgtagacccaaccttggcacttagtgtgtacctg
agggcaaatgttccaaataaagttatccagtgctttgcagaaacaggccaagtacagaag
attgtactgtatgccaagaaagttggttatactccagactggatctttctgttgagaaat
gtaatgaggatcagcccagatcaaggtcaacagtttgctcaaatgttggttcaagatgaa
gaaccacttgctgatataacacagattgttgatgtatttatggaatacaacttaatccag
cagtgcactgcatttttactagatgccctgaagaataatcgcccatctgagggtcccttg
caaacacggttgcttgagatgaacctaatgcatgctcctcaagttgcagatgctatttta
gggaaccagatgttcacgcattatgaccgggctcatatcgctcaactctgtgaaaaagct
ggcctgttacagcgtgcactggagcacttcactgatctgtatgatattaagcgtgcagtt
gttcacacccatcttctgaatcctgagtggttagtcaattactttggctccttatctgtg
gaagattccctggagtgtcttagggctatgctttctgccaatattcgccaaaacctacaa
atttgtgtccaggtggcttccaaatatcatgaacaactctcaactcagtccctgattgaa
ctatttgaatcttttaagagttttgaaggacttttttatttcctgggatccattgtcaac
ttcagtcaggacccagatgtgcactttaaatatattcaggcagcctgtaagactggacag
atcaaagaggtagagagaatctgccgagagagtaactgttatgatccagagagggtcaag
aactttctcaaggaagcaaaactaacagaccagttaccactcatcattgtttgtgatcga
tttgactttgttcatgacttggtgctctacttatatagaaataatctccagaaatatatt
gagatttatgtacagaaggtgaatccaagtcgtctcccagtagttattgggggattgctt
gatgttgattgctctgaagatgtcataaagaacttgattcttgtagtgagaggtcagttt
tctactgatgaacttgttgctgaagttgaaaagaggaacagattaaaacttctactgcct
tggctagaagccagaattcatgagggttgtgaggagcctgctactcacaatgcactagct
aaaatctacattgacagtaacaacaacccagaaagatttcttcgtgaaaatccttattat
gacagtcgtgttgttggaaaatattgtgagaagagggatccccacttagcatgtgtggct
tatgaacgtggccagtgtgatttggaacttattaatgtttgcaatgaaaactctctcttc
aaaagtctttcccgctatttggttcgccgtaaggatccagagctttggggtagtgttctc
ctagagagcaatccttataggaggcccctgattgaccaggttgtacagacagctttgtct
gagactcaagatcctgaagaggtatctgttactgtcaaagctttcatgactgcagacctt
cccaatgaactcattgaactattggagaaaattgttcttgacaactcagtattcagtgaa
cacaggaatctacaaaacctccttatcctaactgcaattaaagctgaccgtacccgtgtt
atggaatatatcaatcgactagataattatgatgctccagatattgctaatattgccatc
agcaatgagttgtttgaggaggcatttgccattttcaggaaatttgatgttaatacttca
gctgtacaggtcttgattgaacacattggaaacctggatcgtgcatatgaatttgctgaa
cgctgcaatgaacctgcagtatggagtcagcttgcaaaggctcagttgcagaaagggatg
gtgaaagaagctattgattcctatatcaaagcggatgacccttcatcttacatggaagtt
gttcaggctgccaatactagtggcaactgggaagaactggttaagtacttgcaaatggct
cgcaagaaggctcgtgaatcttatgtagagacagaactgatttttgctctagctaaaacc
aatcgccttgcagagctggaggaattcatcaatgggccaaataatgcccatattcaacaa
gttggggaccgttgttatgatgagaaaatgtatgatgctgctaaattgttatacaacaat
gtttccaactttggtcgcttggcatctaccctagttcacttgggtgaatatcaggcagct
gttgatggggcccggaaagctaacagcactagaacgtggaaggaggtctgctttgcctgt
gtagatgggaaagagttccgcttggcccaaatgtgtgggcttcatattgtagttcatgca
gatgagctggaggagctcataaactactaccaggatcgaggatactttgaagaactgatc
accatgttggaagcagcactcggacttgagcgagcccacatgggaatgtttactgaatta
gcaattctctactcaaaattcaagccacagaaaatgagggagcatttggagttgttctgg
tccagagttaatattccaaaggtgctaagggctgcagaacaagcacatctttgggcagag
ctggtatttttatacgataaatatgaagaatatgacaatgccataattactatgatgaat
catccaacagatgcctggaaagaaggacagtttaaggatattattaccaaggtagccaat
gtggaactatattatagagcaatacaattctatttagaattcaaacctctactactaaat
gacctgctgatggtactgtctccaaggttggatcacactcgtgctgtcaactatttcagt
aaggttaaacaacttccattggttaaaccatacctacgctctgttcaaaaccataacaac
aagtcagtgaatgaatcattgaataacctcttcattacggaagaagattaccaggcacta
agaacatcaatagatgcatatgacaatttcgataatatctctcttgctcaacgtttggag
aaacatgagcttattgaatttagaagaattgctgcatatctcttcaaaggcaacaatcgc
tggaaacagagtgtagagctatgcaaaaaagaccgactttataaggatgcaatgcagtat
gcctctgaatcaaaagatacagagttggcagaagagctgctacagtggtttttgcaggaa
gaaaagagagaatgctttggagcttgtctcttcacttgttatgatcttttaaggccagat
gttgtcttggaaactgcgtggaggcacaatattatggactttgccatgccctattttatc
caggtcatgaaggaatacttgtccaaggtggataaactggatgcttcagaatccctgaga
aaagaagaggagcaggctacagaaacacaacctatcgtttatggtcaaccacagttgatg
ttgacagcgggacccagcgtagcagttcctccccaagcaccttttggctatggctatact
gcgcccccctatggtcagccacaacctggctttgggtacagcatgtga

  All links  
No link information was found.   
DBGET integrated database retrieval system