KEGG   Monodelphis domestica (opossum): 100010713Help
Entry
100010713         CDS       T01031                                 

Gene name
CLTC
Definition
clathrin, heavy chain (Hc)
Orthology
K04646  
clathrin heavy chain
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysosome
Endocytosis
Synaptic vesicle cycle
Endocrine and other factor-regulated calcium reabsorption
Huntington's disease
Bacterial invasion of epithelial cells
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:mdo04144]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mdo04142]
Organismal Systems; Excretory system; Endocrine and other factor-regulated calcium reabsorption [PATH:mdo04961]
Organismal Systems; Nervous system; Synaptic vesicle cycle [PATH:mdo04721]
Human Diseases; Neurodegenerative diseases; Huntington's disease [PATH:mdo05016]
Human Diseases; Infectious diseases; Bacterial invasion of epithelial cells [PATH:mdo05100]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 1666 aa AA seqDB search
MHKSELQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISAD
SAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYH
WSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRK
VSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVD
VFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPH
EATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEELFARKFN
ALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFGILLDQGQLNK
YESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVYLRANVPNKVI
QCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQDEEPLADITQI
VDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAILGNQMFTHYD
RAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLSVEDSLECLRA
MLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIVNFSQDPDVHF
KYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCDRFDFVHDLVL
YLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQFSTDELVAEV
EKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPYYDSRVVGKYC
EKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSVLLESNPYRRP
LIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSEHRNLQNLLI
LTAIKADRTRVMEYINRLDNYDAPDIANIAISNELFEEAFAIFRKFDVNTSAVQVLIEHI
GNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYMEVVQAANTSGN
WEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQQVGDRCYDEK
MYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFACVDGKEFRLA
QMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTELAILYSKFKP
QKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMMNHPTDAWKEG
QFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYFSKVKQLPLVK
PYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRLEKHELIEFRR
IAAYLFKGNNRWKQSVELCKKDRLYKDAMQYASESKDTELAEELLQWFLQEEKRECFGAC
LFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLSKVDKLDASESLRKEEEQATET
QPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5001 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaagtgagctccagaatctgggtatcaacccagcaaatattggcttcagtact
ttgactatggagtcggacaaattcatctgcattagagaaaaagtaggagagcaagcccag
gtggtaatcattgatatgaatgatccaagtaatcccattcgtcgaccaatttcagctgac
agcgccatcatgaatccagctagcaaagtgattgcattaaaagctgggaaaacacttcag
atatttaacattgaaatgaaaagtaaaatgaaggctcacaccatgactgatgatgtcacc
ttttggaaatggatctctttgaacactgttgcccttgttacggacaatgcagtctatcat
tggagtatggaaggagagtcacaaccagtgaagatgtttgatcgccattctagtcttgct
ggttgccagattatcaactatcgtacagatgcaaagcagaagtggttacttcttactggc
atatctgcacagcaaaatcgtgtggtgggagccatgcaactttattctgtagacagaaaa
gtgtctcagcccattgaaggacatgctgctagctttgcacaatttaagatggaaggaaat
gctgaagagtcaacactgttttgctttgcagtaagggggcaagctggaggcaagttacat
atcattgaagttggcacaccacctacagggaatcagccttttccaaagaaagcagtagat
gtcttctttcctccagaagcacaaaatgattttcctgtggcaatgcagatcagtgaaaaa
cacgatgtggtgttcttgattaccaaatatggatatatccatttatatgacctggagact
ggcacctgcatctacatgaatagaatcagtggagaaaccatctttgttactgcacctcat
gaagcaacagctggaattattggtgtaaacagaaagggacaagtgctgtcagtgtgtgtg
gaagaagagaatataattccttacatcaccaacgtcctacagaatcctgatctggctttg
agaatggctgtgcgtaacaacttagctggagctgaagagctttttgcccggaaatttaat
gctctctttgcccaaggaaattactcagaggcagcaaaagtggctgctaatgcaccaaag
ggaattttacgtactccagacaccatccgtcggttccagagtgttccagcacaaccgggc
cagacgtcacctctacttcagtactttggaatccttttagaccaaggccaactaaataaa
tatgaatccttagaactgtgtaggcctgtgcttcaacagggacgtaaacagctgttagag
aaatggttaaaagaagataagttggagtgttcagaagaattgggtgatctagtaaagtct
gtagacccaaccttggcacttagtgtgtacctgagggcaaatgttccaaataaagttatc
cagtgctttgcagaaacaggccaagtacagaagattgtactgtatgccaagaaagttggt
tatactccagactggatctttctgttgagaaatgtaatgaggatcagcccagatcaaggt
caacagtttgctcaaatgttggttcaagatgaagaaccacttgctgatataacacagatt
gttgatgtatttatggaatacaacttaatccagcagtgcactgcatttttactagatgcc
ctgaagaataatcgcccatctgagggtcccttgcaaacacggttgcttgagatgaaccta
atgcatgctcctcaagttgcagatgctattttagggaaccagatgttcacgcattatgac
cgggctcatatcgctcaactctgtgaaaaagctggcctgttacagcgtgcactggagcac
ttcactgatctgtatgatattaagcgtgcagttgttcacacccatcttctgaatcctgag
tggttagtcaattactttggctccttatctgtggaagattccctggagtgtcttagggct
atgctttctgccaatattcgccaaaacctacaaatttgtgtccaggtggcttccaaatat
catgaacaactctcaactcagtccctgattgaactatttgaatcttttaagagttttgaa
ggacttttttatttcctgggatccattgtcaacttcagtcaggacccagatgtgcacttt
aaatatattcaggcagcctgtaagactggacagatcaaagaggtagagagaatctgccga
gagagtaactgttatgatccagagagggtcaagaactttctcaaggaagcaaaactaaca
gaccagttaccactcatcattgtttgtgatcgatttgactttgttcatgacttggtgctc
tacttatatagaaataatctccagaaatatattgagatttatgtacagaaggtgaatcca
agtcgtctcccagtagttattgggggattgcttgatgttgattgctctgaagatgtcata
aagaacttgattcttgtagtgagaggtcagttttctactgatgaacttgttgctgaagtt
gaaaagaggaacagattaaaacttctactgccttggctagaagccagaattcatgagggt
tgtgaggagcctgctactcacaatgcactagctaaaatctacattgacagtaacaacaac
ccagaaagatttcttcgtgaaaatccttattatgacagtcgtgttgttggaaaatattgt
gagaagagggatccccacttagcatgtgtggcttatgaacgtggccagtgtgatttggaa
cttattaatgtttgcaatgaaaactctctcttcaaaagtctttcccgctatttggttcgc
cgtaaggatccagagctttggggtagtgttctcctagagagcaatccttataggaggccc
ctgattgaccaggttgtacagacagctttgtctgagactcaagatcctgaagaggtatct
gttactgtcaaagctttcatgactgcagaccttcccaatgaactcattgaactattggag
aaaattgttcttgacaactcagtattcagtgaacacaggaatctacaaaacctccttatc
ctaactgcaattaaagctgaccgtacccgtgttatggaatatatcaatcgactagataat
tatgatgctccagatattgctaatattgccatcagcaatgagttgtttgaggaggcattt
gccattttcaggaaatttgatgttaatacttcagctgtacaggtcttgattgaacacatt
ggaaacctggatcgtgcatatgaatttgctgaacgctgcaatgaacctgcagtatggagt
cagcttgcaaaggctcagttgcagaaagggatggtgaaagaagctattgattcctatatc
aaagcggatgacccttcatcttacatggaagttgttcaggctgccaatactagtggcaac
tgggaagaactggttaagtacttgcaaatggctcgcaagaaggctcgtgaatcttatgta
gagacagaactgatttttgctctagctaaaaccaatcgccttgcagagctggaggaattc
atcaatgggccaaataatgcccatattcaacaagttggggaccgttgttatgatgagaaa
atgtatgatgctgctaaattgttatacaacaatgtttccaactttggtcgcttggcatct
accctagttcacttgggtgaatatcaggcagctgttgatggggcccggaaagctaacagc
actagaacgtggaaggaggtctgctttgcctgtgtagatgggaaagagttccgcttggcc
caaatgtgtgggcttcatattgtagttcatgcagatgagctggaggagctcataaactac
taccaggatcgaggatactttgaagaactgatcaccatgttggaagcagcactcggactt
gagcgagcccacatgggaatgtttactgaattagcaattctctactcaaaattcaagcca
cagaaaatgagggagcatttggagttgttctggtccagagttaatattccaaaggtgcta
agggctgcagaacaagcacatctttgggcagagctggtatttttatacgataaatatgaa
gaatatgacaatgccataattactatgatgaatcatccaacagatgcctggaaagaagga
cagtttaaggatattattaccaaggtagccaatgtggaactatattatagagcaatacaa
ttctatttagaattcaaacctctactactaaatgacctgctgatggtactgtctccaagg
ttggatcacactcgtgctgtcaactatttcagtaaggttaaacaacttccattggttaaa
ccatacctacgctctgttcaaaaccataacaacaagtcagtgaatgaatcattgaataac
ctcttcattacggaagaagattaccaggcactaagaacatcaatagatgcatatgacaat
ttcgataatatctctcttgctcaacgtttggagaaacatgagcttattgaatttagaaga
attgctgcatatctcttcaaaggcaacaatcgctggaaacagagtgtagagctatgcaaa
aaagaccgactttataaggatgcaatgcagtatgcctctgaatcaaaagatacagagttg
gcagaagagctgctacagtggtttttgcaggaagaaaagagagaatgctttggagcttgt
ctcttcacttgttatgatcttttaaggccagatgttgtcttggaaactgcgtggaggcac
aatattatggactttgccatgccctattttatccaggtcatgaaggaatacttgtccaag
gtggataaactggatgcttcagaatccctgagaaaagaagaggagcaggctacagaaaca
caacctatcgtttatggtcaaccacagttgatgttgacagcgggacccagcgtagcagtt
cctccccaagcaccttttggctatggctatactgcgcccccctatggtcagccacaacct
ggctttgggtacagcatgtga

DBGET integrated database retrieval system