KEGG   Monodelphis domestica (opossum): 100010734Help
Entry
100010734         CDS       T01031                                 

Gene name
GALM
Definition
galactose mutarotase (aldose 1-epimerase)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100010734 (GALM)
   00052 Galactose metabolism
    100010734 (GALM)
Enzymes [BR:mdo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     100010734 (GALM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 342 aa AA seqDB search
MASVTRSVFGNLPDGAGTVEKFQLQSDLLRVEIISLGCIITALEVKDRDGKFSDVVLGFS
ELEGYLKKHPYFGAVVGRVANRIAKGTFAIDGKEYKLAINKEPNSLHGGFKGFDKVLWTP
QVLPNGIQFSRISPDGEEGYPGELKVWVTYTLDGGQLTVNYKAQTSSTTPVNMTNHSYFN
LAGQGSPNIYDHEICINAEAYLPVDDTLIPTGKVESVQGTAFDLRKPVVLGKHFEKFQIS
GFDHNFCLKDSQEKHFCARVYHPPTGRALEVYTTQPGVQFYTANFLDGTLKGKGGAVYPK
HSGFCLETQNWPDAVNKPHFPRVLLQPGEEYNHTTWFNFSVA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagtgaccaggagtgtgtttggaaacctgcccgatggagcagggacggtagag
aagttccagttgcagtcagacctgctgagggtagagattatctccctaggctgcatcatc
accgctttggaggtgaaagacagggatgggaaattctcagatgtggtgctgggcttttcg
gaactcgaagggtatctcaaaaagcatccatactttggagcagtagttggaagagtggct
aaccgaattgccaaagggacattcgctatagatgggaaggaatacaagttggctattaac
aaagaacccaatagtctacatggaggatttaaaggatttgacaaggtcctttggacccct
caggtgttaccaaatggcattcaattctcccggatcagtccagatggtgaggaaggctac
cctggcgagttgaaagtttgggtcacgtacacactcgatggggggcagttaactgtgaat
tacaaagcccagaccagcagcaccacacctgtcaacatgaccaaccactcttatttcaac
ctggcaggccagggttctccaaatatatatgatcatgaaatctgtataaatgctgaagct
tatttgcctgtggatgatactcttatcccaactggaaaagtggaatctgtgcaggggact
gcatttgacctgagaaagcccgtggtacttggaaagcactttgagaagttccagatcagt
ggttttgaccataacttctgtctgaaggattcacaagagaagcatttttgtgcaagggtt
tatcatcctcctactggacgggcactagaagtatatacaacccagcctggggttcagttt
tatacagccaatttcctggatggaacactgaagggaaaggggggtgccgtgtaccccaaa
cactcaggcttctgccttgagacccagaactggccagatgcagtcaataagccacatttt
cctcgtgtactgctccagccaggtgaagagtataaccacactacttggttcaacttttct
gtagcctaa

DBGET integrated database retrieval system