KEGG   Monodelphis domestica (opossum): 100010745Help
Entry
100010745         CDS       T01031                                 

Definition
cytochrome P450 3A24-like
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:mdo00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:mdo00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mdo00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mdo05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 505 aa AA seqDB search
MNIIPSLSAGTWTLIVLFLTLLYLYGTRTHKLFKNLGIPGPTPLPFFGTVLAYRKGFADF
DYGCFKKYGKTWGFFDGRQAVLAIMDPETIKTVLVKECYSVFTNRRMFGPSGFLEKAISI
AKDEQWKRIRTVLSPTFTSGKLKEMFPIINQYGDVLVKNMKKEAEKSKPVTMKEIFGAYS
MDVITSTSFGIHVDSLNNQNDPFVREIRKLIRFSFLDPLILSITIFPFLIPLFKKLDITV
FPKEATDFLAKSIIKIKEERTKSTEKHRVDFLQLMMDSQTSKNSESHSQKDLSDEEILAQ
SIIFIFAGYETTSSVLSFLFYHLATNPKIQEKLQKEIDAFLPNKEAVTYDALVQMEYLDM
VINENLRLYPIAGRIERVAKKTVELNGLTIPKGTVVMAPPYVLHRDPEYWPEPEEFRPER
FSKENKESINPYVYLPFGAGPRNCIGMRFALMSMKVAVSRLLQEFSFRPCKETQIPLKLS
NQPLLTPTVPIVLQAELRNKKGNQH
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcattccaagtttgagtgctggaacctggacactcatcgttctctttctgact
ctcctgtatctatatgggaccaggacacacaagttatttaagaacttaggaattccagga
ccgacacctcttcctttctttggcactgttcttgcctatcgcaaaggttttgcagatttt
gactatggatgttttaaaaaatatgggaaaacttgggggttttttgatggcagacaagct
gtgttggccatcatggacccagagacaatcaaaacagtgctggtaaaagagtgctattct
gtcttcaccaatcgtcggatgtttggtccatcagggtttttggagaaggccatctcaatt
gctaaagatgagcaatggaagaggatccggacagtgctgtctccaacatttacaagtgga
aaacttaaggagatgtttcctatcataaaccaatatggagatgtcttagtgaagaacatg
aagaaagaagcagagaaaagcaagcctgtaactatgaaagagatctttggggcatacagc
atggatgtaatcaccagtacttcctttggaatacatgttgattccttgaataatcagaat
gatccctttgttagagaaatcagaaagctaattagattcagttttctggacccactcatt
ctttcaataacaattttcccattccttattcctttgtttaagaaattggatataactgta
tttccaaaagaagctacagatttcctagctaaatctattataaaaataaaagaggaacga
acgaaatctacagagaagcatcgggtagatttccttcaacttatgatggattcccagact
tctaaaaattcagagtcacactctcaaaaagatctgagtgatgaagaaattctggctcaa
tccatcatctttatttttgctggctatgaaaccaccagctctgtcctttccttccttttt
tatcatttggctaccaatcctaaaatccaggagaaacttcagaaggagatagatgcattt
ctgcccaacaaggaagctgtcacctatgatgccctggtacagatggaatacctagacatg
gtgatcaatgaaaatctcaggctgtaccccatagcgggtaggattgaaagggttgctaag
aaaactgtggagctcaatggcttgacaattcctaagggaacggtggtgatggctcctccc
tatgtccttcatcgtgacccagaatactggccagaaccagaagagtttcgtcctgaaagg
ttcagtaaggaaaacaaggagagcatcaacccctatgtgtacctgccctttggtgctgga
cctcgaaactgcattgggatgagatttgcacttatgagtatgaaagttgctgttagccga
ctcctgcaggaattctccttcagaccttgtaaagagacacagattcccctgaagttgagc
aatcagccactccttacacctactgtacctatcgttctgcaagctgaattaaggaataag
aaaggaaatcaacactag

DBGET integrated database retrieval system