KEGG   Monodelphis domestica (opossum): 100010818Help
Entry
100010818         CDS       T01031                                 

Gene name
UGT2A1, UGT2B17
Definition
UDP glucuronosyltransferase 2 family, polypeptide A1, complex locus
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100010818 (UGT2A1)
   00053 Ascorbate and aldarate metabolism
    100010818 (UGT2A1)
   00500 Starch and sucrose metabolism
    100010818 (UGT2A1)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100010818 (UGT2A1)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100010818 (UGT2A1)
   00860 Porphyrin and chlorophyll metabolism
    100010818 (UGT2A1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100010818 (UGT2A1)
   00982 Drug metabolism - cytochrome P450
    100010818 (UGT2A1)
   00983 Drug metabolism - other enzymes
    100010818 (UGT2A1)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100010818 (UGT2A1)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     100010818 (UGT2A1)
Glycosyltransferases [BR:mdo01003]
 Others
  Hydrophobic molecule
   100010818 (UGT2A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 557 aa AA seqDB search
MLPHRDADLYGKKKLFTLDSTKVSTSRSTMLGKNSLLLALQMTLLGTVFGGNVLIWPMEG
SHWLNIKIILGKLIEKHHNVTVLVASGALFISPINESSWKSEVYKVPFGKEKIEGVIRNF
VLTWLENMPSPATLWQFYSEMTKVIHEFHQVSQAMCDGVLTNLKLMEKLQKGKFDILISD
PVFPCGDLVALKLGIPFVYSLRFSPASTVEKHCGKVPYPPSYVPAVLSELTDKMSFSDRI
RNFVSYHLQDYMFNTLWSPWDSYYSKILGRPTTLCETMGKAEMWLIRTYWDFEFPRPYLP
NFEFVGGLHCKPAKPLPEEMEKFVQSSGDHGIVVFSLGSMVKNLTDEKSNVIAAALAQIP
QKVLWRYKGKKPATLGPNTKTYDWIPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVG
VPMFADQPDNIAHMKAKGAAVEVNFNKMTTADLLNALKTVINDPSYKENAMRLSRIHHDQ
PVKPLDRAVFWIEFVMRHKGAKHLRPAAHDLTWYQYHSLDVIGFLLACVATVVFIVAKSC
LFCCRKFGKTGKKQKRA
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgctgccacacagagatgctgacttatatggaaaaaaaaaactctttactttggattcc
accaaggtttccacatcaaggtccaccatgttggggaaaaacagcttgttactggctctt
cagatgacactactgggaacagtctttgggggaaatgtcctcatttggccaatggaaggt
agtcactggcttaatattaagataattttagggaaattgatagaaaaacatcacaatgtc
acagtattggttgcttctggagcactgttcatttcacctattaatgagtcctcttggaag
tctgaagtatataaagtgccctttggaaaggaaaaaatagagggtgtcatcaggaatttt
gttctcacatggctggaaaatatgccctccccagcaaccctctggcaattctactcggaa
atgaccaaagtcattcatgagttccaccaagtgagccaagcaatgtgtgatggtgtactt
accaatctgaagttaatggaaaaactacagaaaggcaaatttgatatcttgatctcagat
ccagtattcccctgtggcgacctggttgctcttaaactaggaatcccatttgtatactcc
ttgagattctctccagcctccaccgtggaaaaacattgtgggaaagttccatatcctcct
tcttatgttcctgctgtcttgtcggagctcactgacaaaatgtcttttagtgacagaata
agaaactttgtctcctaccatttacaggactacatgtttaatactctttggtcaccatgg
gactcctactatagcaaaattttgggaagaccaactacattatgtgaaaccatggggaaa
gctgaaatgtggctgattcgaacgtactgggattttgaatttcctcgtccttacttgcca
aattttgagtttgtgggaggactccactgtaaacctgccaagcctcttcctgaggaaatg
gaaaaatttgtccagagctctggggaccatggtattgtggtgttttctcttgggtcaatg
gtgaaaaacttaactgatgaaaagagtaatgtgattgctgcagctcttgcccagattcca
cagaaggttctgtggcgatacaaaggaaagaagccagccacattaggtccaaataccaaa
acctatgactggattccccagaatgatcttcttggtcaccccaaaaccaaggcttttatc
actcatggtggaaccaatggaatctacgaagctatctatcatggaattcccatggtaggc
gtacccatgtttgctgatcagcctgataacattgctcacatgaaggccaagggagcagct
gtcgaggtgaactttaataaaatgacaacagctgacctgcttaatgctttgaagacagtc
atcaatgatccttcatacaaagaaaatgctatgagattatcaagaattcatcatgaccaa
cctgtgaaacccctagatcgagctgtcttctggatcgagtttgtgatgcgtcacaaaggt
gctaagcaccttcgacctgctgcccatgacctcacctggtaccagtaccattccttggat
gtgattggcttcctacttgcctgtgtggcaactgttgtctttatagttgctaaatcctgc
ttgttttgctgccggaaatttggtaaaacaggaaagaaacaaaagagggcataa

DBGET integrated database retrieval system