KEGG   Monodelphis domestica (opossum): 100010844Help
Entry
100010844         CDS       T01031                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase-like
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mdo03410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 271 aa AA seqDB search
MSQPLASRVGLPEEPDLLKLPSSPSSLAQDFLEEELRLNAELDKLQFSEPVGFIYNPLKY
ALELHRNYVTRYCQGPKKVLFLGMNPGPFGMAQTGVPFGEVSVVRDWLGIVGTVLAPPQE
HPKRPILGLECPQSEVSGARFWGFFRALCGQPETFFRHCFVHNLCPLLFLAPTGRNLTPA
ELPAKQREQLLGICDAALRRQVQLLGIRLVIGVGRLAEQRARRALADMVPEVQVEGLLHP
SPRSPQANRGWEAVARERLKELGLMPLLTVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagccactggcttcccgagtgggcctcccagaggaacctgacttgctgaagctt
cctagctctccttccagcctggcccaggatttcctagaggaagaattaagactaaatgct
gaattggacaagcttcagttctcagagcctgtgggctttatttataatcccttgaaatac
gccttggaacttcaccgaaactatgttaccagatactgtcaaggtcccaagaaagtgctg
tttttgggcatgaacccagggccctttggcatggcccagactggggtgccctttggggag
gtgtctgtggtccgggactggctgggcattgtggggacagtgttagccccaccccaggag
catcccaagcggccaatcctggggctagagtgcccacagtcggaggtgagtggtgctcgg
ttttggggctttttccgtgccctctgtgggcaacctgagactttcttcagacactgcttt
gtccacaacctatgtcctcttcttttcttggcccctactggacgcaatctcacacctgca
gagctacctgccaagcaaagagagcagcttctgggcatatgtgatgctgcccttagacgc
caggtgcaactactgggtattcgcctggtgataggagtggggcgcctggcagaacaacgg
gctcgccgggccctggcagacatggtgcctgaggtacaggtagaagggcttctgcatcct
tcccctcgaagcccacaggccaaccgtggatgggaggctgtggctagagaacgactgaag
gagttgggcctcatgcctctgctgacggttgaatga

DBGET integrated database retrieval system