KEGG   Monodelphis domestica (opossum): 100010844Help
Entry
100010844         CDS       T01031                                 

Definition
single-strand selective monofunctional uracil DNA glycosylase-like
Orthology
K10800  
single-strand selective monofunctional uracil DNA glycosylase [EC:3.2.2.-]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    100010844
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.-  
     100010844
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 281 aa AA seqDB search
MFQYCTGDISMSQPLASRVGLPEEPDLLKLPSSPSSLAQDFLEEELRLNAELDKLQFSEP
VGFIYNPLKYALELHRNYVTRYCQGPKKVLFLGMNPGPFGMAQTGVPFGEVSVVRDWLGI
VGTVLAPPQEHPKRPILGLECPQSEVSGARFWGFFRALCGQPETFFRHCFVHNLCPLLFL
APTGRNLTPAELPAKQREQLLGICDAALRRQVQLLGIRLVIGVGRLAEQRARRALADMVP
EVQVEGLLHPSPRSPQANRGWEAVARERLKELGLMPLLTVE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatattgtacaggtgatatcagcatgtcccagccactggcttcccgagtgggc
ctcccagaggaacctgacttgctgaagcttcctagctctccttccagcctggcccaggat
ttcctagaggaagaattaagactaaatgctgaattggacaagcttcagttctcagagcct
gtgggctttatttataatcccttgaaatacgccttggaacttcaccgaaactatgttacc
agatactgtcaaggtcccaagaaagtgctgtttttgggcatgaacccagggccctttggc
atggcccagactggggtgccctttggggaggtgtctgtggtccgggactggctgggcatt
gtggggacagtgttagccccaccccaggagcatcccaagcggccaatcctggggctagag
tgcccacagtcggaggtgagtggtgctcggttttggggctttttccgtgccctctgtggg
caacctgagactttcttcagacactgctttgtccacaacctatgtcctcttcttttcttg
gcccctactggacgcaatctcacacctgcagagctacctgccaagcaaagagagcagctt
ctgggcatatgtgatgctgcccttagacgccaggtgcaactactgggtattcgcctggtg
ataggagtggggcgcctggcagaacaacgggctcgccgggccctggcagacatggtgcct
gaggtacaggtagaagggcttctgcatccttcccctcgaagcccacaggccaaccgtgga
tgggaggctgtggctagagaacgactgaaggagttgggcctcatgcctctgctgacggtt
gaatga

DBGET integrated database retrieval system