KEGG   Monodelphis domestica (opossum): 100010912Help
Entry
100010912         CDS       T01031                                 

Gene name
JOSD1
Definition
Josephin domain containing 1
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100010912 (JOSD1)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C86
   100010912 (JOSD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
8
AA seq 202 aa AA seqDB search
MSCMPWRGDKTKSGSLELPQPAPPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIF
QRLSPNTMVTPHKKSMLGNGNYDVNVIMAALQTKGYEAVWWDKRRDVSVIALSNVMGFIM
NLPSSLCWGPLKLPLKRQHWICVREVGGTYYNLDSKLKMPEWIGGESELRKFLKHQLRGK
NCELLLVVPEEVEAHQTWRADV
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagttgcatgccatggagaggtgacaagaccaaatcaggatcattagaactaccccag
ccagcgcccccccaaatctaccatgagaagcagcgccgtgagctgtgtgccctccatgca
ctcaacaatgtcttccaggacagcaacgccttcacccgggaaacactacaggagattttc
cagagactgtctccaaacaccatggtgacaccccacaagaagagcatgctgggaaatggg
aactatgatgtgaatgtcatcatggcggcccttcagaccaagggctatgaagcagtttgg
tgggacaagcgaagggatgtcagtgtcattgccctctctaatgtcatgggcttcatcatg
aatctcccctctagcctctgctggggtccattgaagcttccactcaaaaggcagcattgg
atctgtgtccgagaggtggggggcacctactacaaccttgactccaagctcaagatgcct
gagtggattggaggcgagagtgagctcaggaaatttttgaaacatcagctccgagggaag
aactgtgagctgctgctggtcgtcccagaagaggtggaggcccaccagacttggagggca
gatgtgtaa

DBGET integrated database retrieval system